DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment asf1 and Asf1a

DIOPT Version :9

Sequence 1:NP_001189131.1 Gene:asf1 / 40141 FlyBaseID:FBgn0029094 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_079817.1 Gene:Asf1a / 66403 MGIID:1913653 Length:204 Species:Mus musculus


Alignment Length:209 Identity:129/209 - (61%)
Similarity:157/209 - (75%) Gaps:17/209 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKVHITNVVVLDNPSSFFNPFQFELTFECIEELKEDLEWKMIYVGSAESEEHDQVLDTIYVGPV 65
            ||||.:.|||||||||.|:||||||:||||||:|.||||||:||||||||||:|||||::.||||
Mouse     1 MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPV 65

  Fly    66 PEGRHIFVFQADPPDVSKIPEPDAVGVTIVLLTCSYRGQEFVRVGYYVNNDYADPEMRENPPTKP 130
            |.|||:||||||.|:...||:.||||||:||:||:||||||:||||||||:|.:.|:|||||.||
Mouse    66 PAGRHMFVFQADAPNAGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKP 130

  Fly   131 LFEKLTRNILASKPRVTRFKINWDYGHINGNGNGVENGH------QDEMATDG-PSTSEAASAVI 188
            .|.||.||||||.||||||.|||:     .|...:|:..      |..::||. ||.|:..|.  
Mouse   131 DFSKLQRNILASNPRVTRFHINWE-----DNTEKLEDAESSNPNLQSLLSTDALPSASKGWST-- 188

  Fly   189 HPEDDNSLAMPMEN 202
               .:|||.:.:|:
Mouse   189 ---SENSLNVMLES 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
asf1NP_001189131.1 ASF1_hist_chap 1..154 CDD:282572 115/152 (76%)
Asf1aNP_079817.1 Interaction with histone H3, CHAF1B, and HIRA. /evidence=ECO:0000250 1..156 116/159 (73%)
ASF1_hist_chap 1..154 CDD:398417 115/152 (76%)
Required for interaction with HIRA. /evidence=ECO:0000250 31..37 3/5 (60%)
Required for interaction with HIRA. /evidence=ECO:0000250 155..204 13/50 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835909
Domainoid 1 1.000 255 1.000 Domainoid score I2032
eggNOG 1 0.900 - - E1_COG5137
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8528
Inparanoid 1 1.050 255 1.000 Inparanoid score I3160
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54218
OrthoDB 1 1.010 - - D1334998at2759
OrthoFinder 1 1.000 - - FOG0001913
OrthoInspector 1 1.000 - - otm44071
orthoMCL 1 0.900 - - OOG6_101293
Panther 1 1.100 - - LDO PTHR12040
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R94
SonicParanoid 1 1.000 - - X1264
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.800

Return to query results.
Submit another query.