DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment asf1 and asf1ba

DIOPT Version :9

Sequence 1:NP_001189131.1 Gene:asf1 / 40141 FlyBaseID:FBgn0029094 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_996946.1 Gene:asf1ba / 386897 ZFINID:ZDB-GENE-031118-197 Length:197 Species:Danio rerio


Alignment Length:199 Identity:121/199 - (60%)
Similarity:150/199 - (75%) Gaps:8/199 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKVHITNVVVLDNPSSFFNPFQFELTFECIEELKEDLEWKMIYVGSAESEEHDQVLDTIYVGPV 65
            ||||.:.||.||||||.|.||||||:||||:|:|.||||||:||||||||||:||.||::.||||
Zfish     1 MAKVQVLNVAVLDNPSPFGNPFQFEITFECMEDLPEDLEWKIIYVGSAESEEYDQTLDSVLVGPV 65

  Fly    66 PEGRHIFVFQADPPDVSKIPEPDAVGVTIVLLTCSYRGQEFVRVGYYVNNDYADPEMRENPPTKP 130
            |.|||:||||||.|:.|.|||.||||||:||:||:||||||:|:||||||:|.|.|:|||||.||
Zfish    66 PAGRHMFVFQADAPNCSLIPETDAVGVTVVLITCTYRGQEFIRIGYYVNNEYTDTELRENPPLKP 130

  Fly   131 LFEKLTRNILASKPRVTRFKINWDYGHINGNGNGVENGHQDEMATDG---PSTSEAASAVIHPED 192
            .:.:|.||||||.||||||.|||:     |....:|:....:.|.:.   ||.:...:.::....
Zfish   131 NYGQLQRNILASNPRVTRFHINWE-----GCAEKMEDSENVDPAPNAMLPPSCTPGKAPLLGLVP 190

  Fly   193 DNSL 196
            |||:
Zfish   191 DNSM 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
asf1NP_001189131.1 ASF1_hist_chap 1..154 CDD:282572 112/152 (74%)
asf1baNP_996946.1 ASF1_hist_chap 1..154 CDD:282572 112/152 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579303
Domainoid 1 1.000 251 1.000 Domainoid score I2060
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8528
Inparanoid 1 1.050 251 1.000 Inparanoid score I3211
OMA 1 1.010 - - QHG54218
OrthoDB 1 1.010 - - D1334998at2759
OrthoFinder 1 1.000 - - FOG0001913
OrthoInspector 1 1.000 - - otm25792
orthoMCL 1 0.900 - - OOG6_101293
Panther 1 1.100 - - O PTHR12040
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R94
SonicParanoid 1 1.000 - - X1264
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.