DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment asf1 and Asf1b

DIOPT Version :9

Sequence 1:NP_001189131.1 Gene:asf1 / 40141 FlyBaseID:FBgn0029094 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001100630.1 Gene:Asf1b / 304648 RGDID:1304918 Length:202 Species:Rattus norvegicus


Alignment Length:232 Identity:126/232 - (54%)
Similarity:152/232 - (65%) Gaps:45/232 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKVHITNVVVLDNPSSFFNPFQFELTFECIEELKEDLEWKMIYVGSAESEEHDQVLDTIYVGPV 65
            ||||.:.||.||:|||.|.:||:||::|||.|.|.:|||||:||||||||||.||:||::.||||
  Rat     1 MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALSDDLEWKIIYVGSAESEEFDQILDSVLVGPV 65

  Fly    66 PEGRHIFVFQADPPDVSKIPEPDAVGVTIVLLTCSYRGQEFVRVGYYVNNDYADPEMRENPPTKP 130
            |.|||:||||||.|:.|.|||.||||||:||:||:|.||||:||||||||:|.|||:|||||.||
  Rat    66 PAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYPDPELRENPPPKP 130

  Fly   131 LFEKLTRNILASKPRVTRFKINWDYGHINGNGNGVENGHQDEMATDGPSTSEAASAVIHPEDDN- 194
            .|.:|.||||||.||||||.||||             .:.|.:.|            |..:|.| 
  Rat   131 DFSQLQRNILASNPRVTRFHINWD-------------NNPDRLET------------IENQDPNV 170

  Fly   195 ------------SLAMPMENGIKA-LNENSNSLAMEC 218
                        :|.:|  |.|.. |.|||    |:|
  Rat   171 DFGLPLSCTPVKNLGLP--NCIPGLLPENS----MDC 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
asf1NP_001189131.1 ASF1_hist_chap 1..154 CDD:282572 109/152 (72%)
Asf1bNP_001100630.1 ASF1_hist_chap 1..154 CDD:398417 109/152 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339546
Domainoid 1 1.000 255 1.000 Domainoid score I1971
eggNOG 1 0.900 - - E1_COG5137
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 256 1.000 Inparanoid score I3086
OMA 1 1.010 - - QHG54218
OrthoDB 1 1.010 - - D1334998at2759
OrthoFinder 1 1.000 - - FOG0001913
OrthoInspector 1 1.000 - - otm46161
orthoMCL 1 0.900 - - OOG6_101293
Panther 1 1.100 - - O PTHR12040
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1264
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.