DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment asf1 and ASF1A

DIOPT Version :9

Sequence 1:NP_001189131.1 Gene:asf1 / 40141 FlyBaseID:FBgn0029094 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_054753.1 Gene:ASF1A / 25842 HGNCID:20995 Length:204 Species:Homo sapiens


Alignment Length:209 Identity:129/209 - (61%)
Similarity:157/209 - (75%) Gaps:17/209 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKVHITNVVVLDNPSSFFNPFQFELTFECIEELKEDLEWKMIYVGSAESEEHDQVLDTIYVGPV 65
            ||||.:.|||||||||.|:||||||:||||||:|.||||||:||||||||||:|||||::.||||
Human     1 MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPV 65

  Fly    66 PEGRHIFVFQADPPDVSKIPEPDAVGVTIVLLTCSYRGQEFVRVGYYVNNDYADPEMRENPPTKP 130
            |.|||:||||||.|:...||:.||||||:||:||:||||||:||||||||:|.:.|:|||||.||
Human    66 PAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKP 130

  Fly   131 LFEKLTRNILASKPRVTRFKINWDYGHINGNGNGVENGH------QDEMATDG-PSTSEAASAVI 188
            .|.||.||||||.||||||.|||:     .|...:|:..      |..::||. ||.|:..|.  
Human   131 DFSKLQRNILASNPRVTRFHINWE-----DNTEKLEDAESSNPNLQSLLSTDALPSASKGWST-- 188

  Fly   189 HPEDDNSLAMPMEN 202
               .:|||.:.:|:
Human   189 ---SENSLNVMLES 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
asf1NP_001189131.1 ASF1_hist_chap 1..154 CDD:282572 115/152 (76%)
ASF1ANP_054753.1 Interaction with histone H3, CHAF1B, and HIRA 1..156 116/159 (73%)
ASF1_hist_chap 1..154 CDD:398417 115/152 (76%)
Required for interaction with HIRA 31..37 3/5 (60%)
Required for interaction with HIRA 155..204 13/50 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145836
Domainoid 1 1.000 254 1.000 Domainoid score I2066
eggNOG 1 0.900 - - E1_COG5137
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8528
Inparanoid 1 1.050 255 1.000 Inparanoid score I3178
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54218
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001913
OrthoInspector 1 1.000 - - otm42018
orthoMCL 1 0.900 - - OOG6_101293
Panther 1 1.100 - - LDO PTHR12040
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R94
SonicParanoid 1 1.000 - - X1264
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.