DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment asf1 and unc-85

DIOPT Version :9

Sequence 1:NP_001189131.1 Gene:asf1 / 40141 FlyBaseID:FBgn0029094 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_494837.2 Gene:unc-85 / 173809 WormBaseID:WBGene00006817 Length:275 Species:Caenorhabditis elegans


Alignment Length:201 Identity:89/201 - (44%)
Similarity:123/201 - (61%) Gaps:21/201 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AKVHITNVVVLDNPSSFFNPFQFELTFECIEELKEDLEWKMIYVGSAESEEHDQVLDTIYVGPVP 66
            ::|:|..|.:||||:.|.:.|:.|:|||..|.|..||||:::||||..|.:.|||||:..|||:|
 Worm     3 SRVNIVQVQILDNPAMFVDKFKLEITFEVFEHLPHDLEWELVYVGSGTSRDFDQVLDSALVGPIP 67

  Fly    67 EGRHIFVFQADPPDVSKIPEPDAVGVTIVLLTCSYRGQEFVRVGYYVNNDYADPEMRENPPTKPL 131
            ||||.|||.||.||:||||..|.|||:::||.|.|..|||:.:|::|.|:|.:.|::||||::||
 Worm    68 EGRHKFVFDADHPDISKIPVDDIVGVSVLLLRCKYNDQEFINMGWFVANEYTEEELKENPPSQPL 132

  Fly   132 FEKLTRNILASKPRVTRFKINWDYGHINGNGNGVENGHQDEMATDGPSTSEAASAVIHPEDDNSL 196
            .|||:|.:.....|:|.|.|.|                .||.....|...||..  :..|||   
 Worm   133 IEKLSRKVETEDLRITTFPIRW----------------TDEDPVAEPVEDEANR--VFAEDD--- 176

  Fly   197 AMPMEN 202
            .||:.:
 Worm   177 LMPLND 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
asf1NP_001189131.1 ASF1_hist_chap 1..154 CDD:282572 78/151 (52%)
unc-85NP_494837.2 ASF1_hist_chap 3..154 CDD:282572 78/150 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158710
Domainoid 1 1.000 183 1.000 Domainoid score I2042
eggNOG 1 0.900 - - E1_COG5137
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8528
Inparanoid 1 1.050 183 1.000 Inparanoid score I2626
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54218
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001913
OrthoInspector 1 1.000 - - otm14649
orthoMCL 1 0.900 - - OOG6_101293
Panther 1 1.100 - - LDO PTHR12040
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R94
SonicParanoid 1 1.000 - - X1264
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.