DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment asf1 and asf1a

DIOPT Version :9

Sequence 1:NP_001189131.1 Gene:asf1 / 40141 FlyBaseID:FBgn0029094 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_031757863.1 Gene:asf1a / 100490579 XenbaseID:XB-GENE-949296 Length:204 Species:Xenopus tropicalis


Alignment Length:220 Identity:129/220 - (58%)
Similarity:155/220 - (70%) Gaps:19/220 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKVHITNVVVLDNPSSFFNPFQFELTFECIEELKEDLEWKMIYVGSAESEEHDQVLDTIYVGPV 65
            ||||.:.|||||||||.|:||||||:||||||:|.||||||:||||||||||:|||||::.||||
 Frog     1 MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPV 65

  Fly    66 PEGRHIFVFQADPPDVSKIPEPDAVGVTIVLLTCSYRGQEFVRVGYYVNNDYADPEMRENPPTKP 130
            |.|||:||||||.|:...||:.||:|||:||:||:||.|||:||||||||:|.:.|:|||||.||
 Frog    66 PAGRHMFVFQADAPNSGLIPDADAIGVTVVLITCTYRDQEFIRVGYYVNNEYTETELRENPPVKP 130

  Fly   131 LFEKLTRNILASKPRVTRFKINWDYGHINGNGNGVENGHQ-DEMATDGPSTSEAASAVIHPEDDN 194
            .|.||.||||||.||||||.|||:           ||..: ||:....|......|....|  ..
 Frog   131 DFSKLQRNILASNPRVTRFHINWE-----------ENTEKLDELEDSNPHLHPILSIEARP--SA 182

  Fly   195 SLAMPM-ENGIKALNENSNSLAMEC 218
            |...|| ||.:..:.|:.    |:|
 Frog   183 SKGWPMSENSLNVMLESH----MDC 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
asf1NP_001189131.1 ASF1_hist_chap 1..154 CDD:282572 113/152 (74%)
asf1aXP_031757863.1 ASF1_hist_chap 1..154 CDD:398417 113/152 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 253 1.000 Domainoid score I2027
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 256 1.000 Inparanoid score I3076
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1334998at2759
OrthoFinder 1 1.000 - - FOG0001913
OrthoInspector 1 1.000 - - otm49247
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1264
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.