DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-F and TSC10

DIOPT Version :9

Sequence 1:NP_649134.3 Gene:PIG-F / 40139 FlyBaseID:FBgn0036893 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_009824.2 Gene:TSC10 / 852568 SGDID:S000000469 Length:320 Species:Saccharomyces cerevisiae


Alignment Length:156 Identity:33/156 - (21%)
Similarity:46/156 - (29%) Gaps:60/156 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QQKTKHQLFHVSLSLATILI-CMAYMQYRRNWA-----------HLGSFWDSLVVPIVFLGELLK 59
            :|..:|.|  :..|.||.|. .:.|.||....|           .|.:|..|.|.|..|..|...
Yeast   155 EQTKEHHL--IIFSSATALYPFVGYSQYAPAKAAIKSLVAILRQELTNFRISCVYPGNFESEGFT 217

  Fly    60 V--------------------------VLARFYGKVEDGV---------------LTAKQRQKKN 83
            |                          ::|:...:.:|.|               ||||:     
Yeast   218 VEQLTKPEITKLIEGPSDAIPCKQACDIIAKSLARGDDDVFTDFVGWMIMGMDLGLTAKK----- 277

  Fly    84 SYFTPRELLGGFTLQFLCTLLYAFIC 109
            |.|.|.:.:.|.....|....|...|
Yeast   278 SRFVPLQWIFGVLSNILVVPFYMVGC 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-FNP_649134.3 PIG-F <81..214 CDD:399588 7/29 (24%)
TSC10NP_009824.2 KDSR-like_SDR_c 7..263 CDD:187643 22/109 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1750
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.