DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-F and AT1G16040

DIOPT Version :9

Sequence 1:NP_649134.3 Gene:PIG-F / 40139 FlyBaseID:FBgn0036893 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_173056.2 Gene:AT1G16040 / 838175 AraportID:AT1G16040 Length:226 Species:Arabidopsis thaliana


Alignment Length:152 Identity:43/152 - (28%)
Similarity:70/152 - (46%) Gaps:15/152 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 KQRQKKNSYF--TPRELLGGFTLQFLCTLLYAFICIILGAPV-LGNYEQTFVLALLMTLLTVSPT 138
            ::..:|.|||  ..|.|:|    .....|:.|...:.||||: :.:..:|...:.||::.||.|.
plant    76 RRNPEKCSYFRAVGRSLVG----LIAGALINALGAVSLGAPIGMQSLSKTIHWSFLMSVFTVVPA 136

  Fly   139 VFLLGGGGA--LQVCFCEKPDFVTKCEDTALNLFKYNALGGILGAWAGSVVAPLDWGRDWQAYPI 201
            ..:||....  .::....||..:.:      ::....|.|.|:|.|.|:...||||.|.||.:||
plant   137 TAVLGASWIDWHRIFASLKPIGIIE------HMLLVPAYGAIIGGWFGAWPMPLDWERPWQEWPI 195

  Fly   202 PNVIGALLGSALGNIYACTHVL 223
            ....||:.|...|.:.:...:|
plant   196 CVCYGAIGGYIGGQMVSLLTLL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-FNP_649134.3 PIG-F <81..214 CDD:399588 41/137 (30%)
AT1G16040NP_173056.2 PIG-F 49..198 CDD:399588 38/131 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I4410
eggNOG 1 0.900 - - E1_KOG3144
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I2638
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1182539at2759
OrthoFinder 1 1.000 - - FOG0005755
OrthoInspector 1 1.000 - - oto3815
orthoMCL 1 0.900 - - OOG6_104722
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3640
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.