DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-F and pigf

DIOPT Version :9

Sequence 1:NP_649134.3 Gene:PIG-F / 40139 FlyBaseID:FBgn0036893 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001016071.1 Gene:pigf / 548825 XenbaseID:XB-GENE-949575 Length:219 Species:Xenopus tropicalis


Alignment Length:229 Identity:60/229 - (26%)
Similarity:102/229 - (44%) Gaps:37/229 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 HVSLSLATIL-ICMAYMQYRRNWAHLGSF--WDSLVVPIVFLGELLKVVLARFYGKVEDGVLTAK 77
            |:..:.|.:| :|:..:.. ..::.||:.  |..:....|.|..:|.::|           |...
 Frog    13 HIFGAFAVVLSVCVPVLSV-DGFSFLGTHLSWLCICSLCVILVNILLLLL-----------LKPN 65

  Fly    78 QRQKKNSYFTPRELLGGFTLQFL--CTLLYAFICIILGAPVLGNYEQTFVLALLMTLLTVSPTVF 140
            ...||.|.......|....:.|:  |.|.:..| ::.|||::.:..:||:.|:|::..|.|..:.
 Frog    66 ASSKKTSLSNKLSKLTKSCIYFVISCFLFHGII-VLYGAPLVESVAETFLFAVLLSSFTTSRCLC 129

  Fly   141 LLGGGGALQVCFCEKPDFVTKCEDTALNLFKYN----ALGGILGAWAGSVVAPLDWGRDWQAYPI 201
            |||...:..|....|        |.||:::.::    .:..::|||.|:...||||.|.||.:||
 Frog   130 LLGPNFSAWVRVFSK--------DGALSVWDHSLQITTVCSVVGAWLGAFPIPLDWDRPWQVWPI 186

  Fly   202 PNVIGALLGSALGNIYACTHVLYATARVYMTKKR 235
            ...:||.||...|       :|.|...:|..:||
 Frog   187 SCSLGATLGYVAG-------LLIAPLWIYCNRKR 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-FNP_649134.3 PIG-F <81..214 CDD:399588 42/138 (30%)
pigfNP_001016071.1 PIG-F 21..204 CDD:369042 54/210 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10185
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I5186
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1182539at2759
OrthoFinder 1 1.000 - - FOG0005755
OrthoInspector 1 1.000 - - oto105333
Panther 1 1.100 - - LDO PTHR43157
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1750
SonicParanoid 1 1.000 - - X3640
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.100

Return to query results.
Submit another query.