DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-F and PIGF

DIOPT Version :9

Sequence 1:NP_649134.3 Gene:PIG-F / 40139 FlyBaseID:FBgn0036893 Length:236 Species:Drosophila melanogaster
Sequence 2:XP_011531210.1 Gene:PIGF / 5281 HGNCID:8962 Length:227 Species:Homo sapiens


Alignment Length:149 Identity:33/149 - (22%)
Similarity:63/149 - (42%) Gaps:36/149 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 CTLLYAFIC-------IILGAPVLGNYEQTFVLALLMTLLTVSPTVFLLGGGGALQVCFCEKPDF 158
            |.:.:...|       ::.|||::....:||:.|::::..|..|.:.|||            |:.
Human    83 CCIYFLMSCFSFHVIFVLYGAPLIELALETFLFAVILSTFTTVPCLCLLG------------PNL 135

  Fly   159 -----------VTKCEDTALNLFKYNALGGILGAWAGSVVAPLDWGRDWQAYPIPNVIGALLGSA 212
                       ||...:.:|.:   ..:...:|||.|::..||||.|.||......:...:|.:.
Human   136 KAWLRVFSRNGVTSIWENSLQI---TTISSFVGAWLGALPIPLDWERPWQGAWYCEMSNLILTTV 197

  Fly   213 LGNIYACTHVLYATARVYM 231
               :....|:|||.:.:::
Human   198 ---VQGMAHLLYAWSDLWL 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-FNP_649134.3 PIG-F <81..214 CDD:399588 29/130 (22%)
PIGFXP_011531210.1 PIG-F 21..185 CDD:284183 28/116 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143763
Domainoid 1 1.000 57 1.000 Domainoid score I10944
eggNOG 1 0.900 - - E1_KOG3144
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 1 Normalized mean entropy S4135
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1182539at2759
OrthoFinder 1 1.000 - - FOG0005755
OrthoInspector 1 1.000 - - oto91566
orthoMCL 1 0.900 - - OOG6_104722
Panther 1 1.100 - - LDO PTHR43157
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1750
SonicParanoid 1 1.000 - - X3640
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.730

Return to query results.
Submit another query.