DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-F and pigf

DIOPT Version :9

Sequence 1:NP_649134.3 Gene:PIG-F / 40139 FlyBaseID:FBgn0036893 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_991208.1 Gene:pigf / 402942 ZFINID:ZDB-GENE-040426-1801 Length:219 Species:Danio rerio


Alignment Length:222 Identity:61/222 - (27%)
Similarity:95/222 - (42%) Gaps:46/222 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 HQLFHVSLSLATILICMAYMQYRRNWAHLGSFWDSLVVPIVFLGELLKVVLARFYGKVEDGVLTA 76
            |.:...|:.:||::......::.....|:  .|...|.     |.:..|.:|.|:      :|..
Zfish    13 HAIIASSIFMATVMPAALVNKFSVYGTHM--VWLYCVA-----GSITVVNIAVFW------LLGI 64

  Fly    77 KQRQKKN--SYFTPRELLGGFTLQFLCTLLYAFICIIL-GAPVLGNYEQTFVLALLMTLLTVSPT 138
            ....|||  ||...|....  .|.||.:.|:....::| |||:|.:..:||.||:|::.||....
Zfish    65 SPPTKKNTLSYKISRFFRS--CLYFLLSCLFFHTVVVLYGAPLLESALETFSLAVLLSTLTTLRC 127

  Fly   139 VFLLGGG-----------GALQVCFCEKPDFVTKCEDTALNLFKYNALG-GILGAWAGSVVAPLD 191
            :.:||..           ||:.|.            ||:|.:    ..| .::|||.|:...|||
Zfish   128 LCILGPNVQAWIRVFSRDGAMSVW------------DTSLQI----TTGCSVIGAWLGAFPIPLD 176

  Fly   192 WGRDWQAYPIPNVIGALLGSALGNIYA 218
            |.|.||.:||...:||.:|...|.:.|
Zfish   177 WDRPWQVWPISCTLGATIGFLTGLLAA 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-FNP_649134.3 PIG-F <81..214 CDD:399588 47/147 (32%)
pigfNP_991208.1 PIG-F 21..204 CDD:284183 59/214 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576706
Domainoid 1 1.000 61 1.000 Domainoid score I10517
eggNOG 1 0.900 - - E1_KOG3144
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5386
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1182539at2759
OrthoFinder 1 1.000 - - FOG0005755
OrthoInspector 1 1.000 - - oto39024
orthoMCL 1 0.900 - - OOG6_104722
Panther 1 1.100 - - LDO PTHR43157
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1750
SonicParanoid 1 1.000 - - X3640
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.830

Return to query results.
Submit another query.