DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-F and F49E8.8

DIOPT Version :9

Sequence 1:NP_649134.3 Gene:PIG-F / 40139 FlyBaseID:FBgn0036893 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001370962.1 Gene:F49E8.8 / 36805013 WormBaseID:WBGene00302976 Length:148 Species:Caenorhabditis elegans


Alignment Length:139 Identity:47/139 - (33%)
Similarity:69/139 - (49%) Gaps:14/139 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 LYAFICIILGAPVLGNYEQTFVLALLMTLLTVSPTVFLLGGGG-----ALQVCFCE-KPDFVTKC 162
            ::..:.::.|||...:...|.|||..:|.::..|.|||.....     .||:..|| .|   |..
 Worm    17 VFYILAVLFGAPFFSDIIATAVLATALTAVSALPAVFLFDSEERAVEVILQLFSCEGNP---TPK 78

  Fly   163 EDTALNLFKYNALGGILGAWAGSVVAPLDWGRDWQAYPIPNVIGALLGSALGNIYACTHVLYATA 227
            |...|    :|::...|||||.:.|.||||.|.||.||:|:::|..:|:.:|...|.|.:.....
 Worm    79 ESVLL----FNSVFAFLGAWAAAAVHPLDWDRWWQRYPLPSLVGCFIGAVIGIFIAITRIFVIKR 139

  Fly   228 RVY-MTKKR 235
            ..| .||||
 Worm   140 TAYNKTKKR 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-FNP_649134.3 PIG-F <81..214 CDD:399588 39/115 (34%)
F49E8.8NP_001370962.1 PIG-F <17..130 CDD:399588 40/119 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157873
Domainoid 1 1.000 70 1.000 Domainoid score I6246
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I3853
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005755
OrthoInspector 1 1.000 - - oto18143
orthoMCL 1 0.900 - - OOG6_104722
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3640
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.790

Return to query results.
Submit another query.