DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lon and AT1G07190

DIOPT Version :10

Sequence 1:NP_730435.2 Gene:Lon / 40138 FlyBaseID:FBgn0036892 Length:1024 Species:Drosophila melanogaster
Sequence 2:NP_172199.1 Gene:AT1G07190 / 837230 AraportID:AT1G07190 Length:54 Species:Arabidopsis thaliana


Alignment Length:55 Identity:19/55 - (34%)
Similarity:28/55 - (50%) Gaps:13/55 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   922 MTGEVSLKGKVLPVGGIKEKTIAARRSGVNCLILPVDNKKDFEELPTYITDGLEV 976
            |||.::|.||:|   |...|||          |.|..:::|.:|||....:|:.|
plant     1 MTGRLTLTGKIL---GSLVKTI----------IFPEADRRDVDELPNNGKEGIHV 42

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LonNP_730435.2 lon 95..990 CDD:273258 19/55 (35%)
AT1G07190NP_172199.1 Lon <1..40 CDD:440234 17/51 (33%)

Return to query results.
Submit another query.