DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and PRSS12

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_003610.2 Gene:PRSS12 / 8492 HGNCID:9477 Length:875 Species:Homo sapiens


Alignment Length:427 Identity:112/427 - (26%)
Similarity:178/427 - (41%) Gaps:91/427 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 QWGESENQVYENRT------GENRVVSFLSQHRL----NKRQAPTSQLLE------------NKD 83
            |||..:....|:.:      ||...:|.....||    ||::......:.            :||
Human   469 QWGRHDCSHREDVSIACYPGGEGHRLSLGFPVRLMDGENKKEGRVEVFINGQWGTICDDGWTDKD 533

  Fly    84 YGACSTPLGESGRCR--------------HI--IYCRMPE------LKNDVWRLVSQLCIIEKSS 126
            .......||..|..|              |:  :.|...|      :|.|:.|...:    ....
Human   534 AAVICRQLGYKGPARARTMAYFGEGKGPIHVDNVKCTGNERSLADCIKQDIGRHNCR----HSED 594

  Fly   127 IGICCT--DQSTSNRFSPQVVTSADGDEPRIVNKPEQRGCG--ITSRQFPRLTGGRPAEPDEWPW 187
            .|:.|.  .:..|...:.:.::|.               ||  :..|:..|:.||:.:....|||
Human   595 AGVICDYFGKKASGNSNKESLSSV---------------CGLRLLHRRQKRIIGGKNSLRGGWPW 644

  Fly   188 MAAL---LQEGLPFVWCGGVLITDRHVLTAAHCI--YKKNKEDIFVRLGEYNTHMLNETRARDFR 247
            ..:|   ...|...:.||..|::...|||||||.  |..:.....||:|:|:| ::.|....:..
Human   645 QVSLRLKSSHGDGRLLCGATLLSSCWVLTAAHCFKRYGNSTRSYAVRVGDYHT-LVPEEFEEEIG 708

  Fly   248 IANMVLHIDYNPQNYDNDIAIVRI----DRATIFNTYIWPVCMPPVNEDWSDR------NAIVTG 302
            :..:|:|.:|.|...|.|||:||:    ::...|::::.|.|:|.    |.:|      |..:||
Human   709 VQQIVIHREYRPDRSDYDIALVRLQGPEEQCARFSSHVLPACLPL----WRERPQKTASNCYITG 769

  Fly   303 WGTQKFGGPHSNILMEVNLPVWKQSDCRSSFVQHVPDTAMCAG--FPEGGQDSCQGDSGGPLLVQ 365
            ||..  |..:|..|.:..:|:..:..|...:........:|||  ......|||||||||||:.:
Human   770 WGDT--GRAYSRTLQQAAIPLLPKRFCEERYKGRFTGRMLCAGNLHEHKRVDSCQGDSGGPLMCE 832

  Fly   366 LPNQRWVTIGIVSWGVGCGQRGRPGIYTRVDRYLDWI 402
            .|.:.||..|:.|||.|||.:..||:||:|..::.||
Human   833 RPGESWVVYGVTSWGYGCGVKDSPGVYTKVSAFVPWI 869

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829 11/66 (17%)
Tryp_SPc 173..402 CDD:214473 80/245 (33%)
Tryp_SPc 176..402 CDD:238113 79/242 (33%)
PRSS12NP_003610.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..88
KR 99..164 CDD:214527
SR 170..270 CDD:214555
SRCR 175..270 CDD:278931
SR 280..380 CDD:214555
SRCR 285..380 CDD:278931
SR 387..486 CDD:214555 4/16 (25%)
SRCR 392..485 CDD:278931 4/15 (27%)
SR 500..599 CDD:214555 17/102 (17%)
SRCR 510..599 CDD:278931 13/92 (14%)
Zymogen activation region 619..630 3/10 (30%)
Tryp_SPc 630..869 CDD:214473 80/245 (33%)
Tryp_SPc 631..872 CDD:238113 81/246 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6614
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.