DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and prss60.1

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:253 Identity:91/253 - (35%)
Similarity:127/253 - (50%) Gaps:27/253 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 CGITSRQFPRLTGGRPAEPDEWPWMAALLQEGLPFVWCGGVLITDRHVLTAAHCIYKKNKEDIFV 228
            ||:.... .|:.||..|....|||..:|........:|||.||....|||||||:.:.....:.|
Zfish    25 CGLAPLN-NRIVGGVNAFDGSWPWQVSLHSPIYGGHFCGGSLINSEWVLTAAHCLPRITTSSLLV 88

  Fly   229 RLGE-----YNTHMLNETRARDFRIANMVLHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCMPP 288
            .||:     .||:.:|.|      ::.:.:|..||....:||||::.:..|..|:.||.|||:..
Zfish    89 FLGKTTQQGVNTYEINRT------VSVITVHPSYNNLTNENDIALLHLSSAVTFSNYIRPVCLAA 147

  Fly   289 VNEDW-SDRNAIVTGWGTQKFGG--PHSNILMEVNLPVWKQSDCRSSFVQ-HVPDTAMCAGFPEG 349
            .|..: :..::.:||||..:.|.  |...||.|..:||.....|.:.... .|.:..:|||..:|
Zfish   148 QNSVFPNGTSSWITGWGNIQLGVNLPAPGILQETMIPVVPNDQCNALLGSGSVTNNMICAGLLQG 212

  Fly   350 GQDSCQGDSGGPL-----LVQLPNQRWVTIGIVSWGVGCGQRGRPGIYTRVDRYLDWI 402
            |:|:||||||||:     ||      ||..||.|||.||.....||:||||.:|..||
Zfish   213 GRDTCQGDSGGPMVSKQCLV------WVQSGITSWGYGCADPYSPGVYTRVSQYQSWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 87/242 (36%)
Tryp_SPc 176..402 CDD:238113 86/239 (36%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 87/242 (36%)
Tryp_SPc 34..267 CDD:238113 88/243 (36%)
Somatomedin_B 349..382 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587671
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.