DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and gzma

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_001335166.1 Gene:gzma / 795070 ZFINID:ZDB-GENE-091204-156 Length:257 Species:Danio rerio


Alignment Length:211 Identity:60/211 - (28%)
Similarity:99/211 - (46%) Gaps:27/211 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 CGGVLITDRHVLTAAHCIYKKNKED----IFVRLGEYNTHMLNETRARDFRIANMVLHIDYNPQN 261
            |||:||....|||||||     |||    :.|.:|..:   |::...| ..|.|..:...:|.:.
Zfish    52 CGGILIHKEWVLTAAHC-----KEDSYSSVTVLIGSLS---LSKGSQR-IAIHNYEIPETFNKKT 107

  Fly   262 YDNDIAIVRIDRATIFNTYIWPVCMPPVNED-WSDRNAIVTGWGTQKFGGPH-SNILMEVNLPVW 324
            ..:||.::|:.:    .....|..:|...:| ......:|.||||..:.|.. |:.|..:.:.|.
Zfish   108 KKDDIMLIRLSK----KVKAKPYKIPKKEKDVQPGTKCVVRGWGTTDYKGKQASDKLQMLEVLVV 168

  Fly   325 KQSDCRSSFVQH--VPDTAMCAGFPEGGQDSCQGDSGGPLLVQLPNQRWVTIGIVSWGVGCGQRG 387
            .:..|...:.::  :....:|||..:..:.:|.|||||||..:..     .:|::|...|||...
Zfish   169 DRVQCNRYYNRNPVITKDMLCAGNTQQHRGTCLGDSGGPLECEKN-----LVGVLSGSHGCGDPK 228

  Fly   388 RPGIYTRVD-RYLDWI 402
            :|.:||.:. |::.||
Zfish   229 KPTVYTLLSKRHITWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 58/209 (28%)
Tryp_SPc 176..402 CDD:238113 58/209 (28%)
gzmaXP_001335166.1 Tryp_SPc 28..247 CDD:238113 60/211 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587643
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.