DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and PRSS8

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens


Alignment Length:275 Identity:92/275 - (33%)
Similarity:140/275 - (50%) Gaps:39/275 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 TSADGDEPRIVNKPEQRGCGITSRQFPRLTGGRPAEPDEWPWMAALLQEGLPFVWCGGVLITDRH 210
            |.|:|.|         ..||:..:  .|:|||..|...:|||..::..||:..  |||.|::::.
Human    28 TGAEGAE---------APCGVAPQ--ARITGGSSAVAGQWPWQVSITYEGVHV--CGGSLVSEQW 79

  Fly   211 VLTAAHCI-YKKNKEDIFVRLGEYNTHMLNETRARDFRIANMVLHIDYNPQNYDNDIAIVRIDRA 274
            ||:||||. .:.:||...|:||.:.....:|. |:...:.:::.|..|..:....|||::::.|.
Human    80 VLSAAHCFPSEHHKEAYEVKLGAHQLDSYSED-AKVSTLKDIIPHPSYLQEGSQGDIALLQLSRP 143

  Fly   275 TIFNTYIWPVCMPPVNEDW-SDRNAIVTGWGTQKFGGPHSNI-----LMEVNLPVWKQSDC---- 329
            ..|:.||.|:|:|..|..: :..:..|||||   ...|..::     |.::.:|:..:..|    
Human   144 ITFSRYIRPICLPAANASFPNGLHCTVTGWG---HVAPSVSLLTPKPLQQLEVPLISRETCNCLY 205

  Fly   330 -------RSSFVQHVPDTAMCAGFPEGGQDSCQGDSGGPLLVQLPNQRWVTIGIVSWGVGCGQRG 387
                   ...|||   :..:|||:.|||:|:|||||||||...:.. .|...||||||..||.|.
Human   206 NIDAKPEEPHFVQ---EDMVCAGYVEGGKDACQGDSGGPLSCPVEG-LWYLTGIVSWGDACGARN 266

  Fly   388 RPGIYTRVDRYLDWI 402
            |||:||....|..||
Human   267 RPGVYTLASSYASWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 84/246 (34%)
Tryp_SPc 176..402 CDD:238113 82/243 (34%)
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 84/246 (34%)
Tryp_SPc 45..284 CDD:238113 85/247 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.