DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and CG11313

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:370 Identity:110/370 - (29%)
Similarity:167/370 - (45%) Gaps:71/370 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 YGACSTPLGESGRCRHIIYCRMPELKNDV----------WRLV--SQLCIIEKSSIG-ICCTDQS 135
            |.:|..|...:|.|.:|..| :|  .|.|          .|.:  |:..:.::|.:. :|||..:
  Fly    21 YVSCRNPNQRTGYCVNIPLC-VP--LNSVLAKSNPTDSEMRFIRESRCLVSDQSDLPFVCCTPDT 82

  Fly   136 TSNRFSPQVVTSADGDEPRIVNK---PEQRGCGITSRQFPRLTGGRPAEPDEWPWMAALLQEGLP 197
            ..|     ...:...||  :::.   |::..|| ....:.::|.|......|:.||  :|.|..|
  Fly    83 DYN-----TTRARPNDE--VIHSTLLPDRSICG-GDIAYNQITKGNETVLTEFAWM--VLLEYRP 137

  Fly   198 F------VWCGGVLITDRHVLTAAHCI---YKKNKED----IFVRLGEYNT----HMLN------ 239
            .      .:|.|.||.:|:|:|||||:   .:..|.|    :.|||||:||    ..||      
  Fly   138 HDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPE 202

  Fly   240 --ETRARDFRIANMVLHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCMPPV--NEDWSDRNAI- 299
              :....:.||     |..:..:.:.||||::|:.|...::..|.|||:|..  .::|....|. 
  Fly   203 PVQIAVEEIRI-----HESFGTRLFWNDIALIRLAREVAYSPSIRPVCLPSTVGLQNWQSGQAFT 262

  Fly   300 VTGWGTQKFGGPHSNILMEVNLPVWKQSDCRSSFVQHV--PDTAMCAGFPEGGQ--DSCQGDSGG 360
            |.||| :......|.:.|::.:...:...||..:...|  .|:.:||   ||..  |||.|||||
  Fly   263 VAGWG-RTLTSESSPVKMKLRVTYVEPGLCRRKYASIVVLGDSHLCA---EGRSRGDSCDGDSGG 323

  Fly   361 PLLVQLPNQRWVTIGIVSWGVGCGQRGRPGIYTRVDRYLDWILAN 405
            ||:. .....||..||||:|:.||.|..|.:||.|..|..||..|
  Fly   324 PLMA-FHEGVWVLGGIVSFGLNCGSRFWPAVYTNVLSYETWITQN 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829 13/57 (23%)
Tryp_SPc 173..402 CDD:214473 85/260 (33%)
Tryp_SPc 176..402 CDD:238113 84/257 (33%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855 12/56 (21%)
Tryp_SPc 116..367 CDD:238113 87/262 (33%)
Tryp_SPc 116..364 CDD:214473 85/259 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457347
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.