DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and CG9737

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:388 Identity:110/388 - (28%)
Similarity:168/388 - (43%) Gaps:88/388 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 GACSTPLGESGRCRHIIYCR----MPELKNDVWRLVSQLCIIEK---------SSIGICC----- 131
            |.|.    |..||:..:..|    :|..|.:..:.|.  |.:|:         .|: :||     
  Fly    37 GVCL----EVSRCKAYLQVRNATNLPAEKVNFLKKVQ--CEVEQQVSEAQGSYESL-VCCPANGQ 94

  Fly   132 --------------------TDQSTSNRFSPQVVTSADGDEPRIVNKPEQRGCG--ITSRQFPRL 174
                                |.:....:...::.|........::|:     ||  :|:    |:
  Fly    95 DYLFPVLQFSKFEYRRFLDVTARFKRKKLKRRIQTVEPSSGFNLLNE-----CGKQVTN----RI 150

  Fly   175 TGGRPAEPDEWPWMAALLQEGLPFVWCGGVLITDRHVLTAAHCIYKKNKED----IFVRLGEYN- 234
            .||..||.||:||:|.|:.....: .|.|.||.|||:||||||:..:...|    ..|||||:| 
  Fly   151 YGGEIAELDEFPWLALLVYNSNDY-GCSGALIDDRHILTAAHCVQGEGVRDRQGLKHVRLGEFNV 214

  Fly   235 ----------THMLNETRARDFRIANMVLHIDYNP-QNYD-NDIAIVRIDRATIFNTYIWPVCMP 287
                      .::.....|.|.....:.:|.:|.. .||. |||||:|:.....|..::.|:|:|
  Fly   215 KTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHFVMPICLP 279

  Fly   288 PVNEDWS---DRNAIVTGWG-----TQKFGGPHSNILMEVNLPVWKQSDCR---SSFVQHVPDTA 341
            ..:|..:   .:...|:|||     .:.|...||.|.:::.:|.....:|.   ..|...:....
  Fly   280 NKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPYVSNENCTKILEGFGVRLGPKQ 344

  Fly   342 MCAGFPEGGQDSCQGDSGGPLL-VQLPNQRWVTIGIVSWG-VGCGQRGRPGIYTRVDRYLDWI 402
            :||| .|..:|:|.|||||||: ....:.|||..|:||:| ..||..|:|.:||.|..|.|||
  Fly   345 ICAG-GEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWI 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829 13/82 (16%)
Tryp_SPc 173..402 CDD:214473 88/258 (34%)
Tryp_SPc 176..402 CDD:238113 87/255 (34%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855 12/58 (21%)
Tryp_SPc 149..406 CDD:214473 88/258 (34%)
Tryp_SPc 150..409 CDD:238113 89/259 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457507
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.