DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and CG11836

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:246 Identity:91/246 - (36%)
Similarity:151/246 - (61%) Gaps:8/246 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 CGITSRQFPRLTGGRPAEPDEWPWMAALLQEGLPFVWCGGVLITDRHVLTAAHCIYKKNKEDIFV 228
            ||.::.:. |:.||:|...:::||||.::.:|.  ..|||.|:|..:||:||||:.|..|..|.|
  Fly    88 CGFSNEEI-RIVGGKPTGVNQYPWMARIVYDGK--FHCGGSLLTKDYVLSAAHCVKKLRKSKIRV 149

  Fly   229 RLGEYNTHMLNETRARDFRIANMVLHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCMPPVNEDW 293
            ..|:::..:.:|::|....:..::.|..::|..|:||||::|:.:...|:..|.|:|:|..|.|.
  Fly   150 IFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYNYDP 214

  Fly   294 SDRNAIVTGWGTQKFGGPHSNILMEVNLPVWKQSDCRSSFVQ--HVPDTAMCAGFPEGGQDSCQG 356
            :.|...|.|||....||...:|:.:|.:|:...::||:...:  .:..:.:|||.|  ..|||||
  Fly   215 AGRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAGRP--SMDSCQG 277

  Fly   357 DSGGPLLVQLPNQRWVTIGIVSWGVGCGQRGRPGIYTRVDRYLDWILANAD 407
            |||||||:. ...::..:||||||||||:.|.||:|:||.:::.||.:|.:
  Fly   278 DSGGPLLLS-NGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNLE 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 86/230 (37%)
Tryp_SPc 176..402 CDD:238113 85/227 (37%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 87/232 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457743
Domainoid 1 1.000 147 1.000 Domainoid score I2768
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I2933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42230
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
65.890

Return to query results.
Submit another query.