DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and CG11670

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster


Alignment Length:250 Identity:83/250 - (33%)
Similarity:126/250 - (50%) Gaps:40/250 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 PDEWPWMAAL--LQEGLPFVW-CGGVLITDRHVLTAAHCIYKKNKEDIFVRLG-----EYNTHML 238
            |.::|.||||  ..|.....: |||.||::..|||||||:.........|::|     |:..::.
  Fly   178 PGQYPHMAALGFRNENHEIDYKCGGSLISEEFVLTAAHCLTTHGTSPDIVKIGDIKLKEWELNVA 242

  Fly   239 NETRARDFRIANMVLHIDYNPQ-NYDNDIAIVRIDRATIFNTYIWPVCMPPVNEDWSDRNAIVTG 302
            .:.|    |:|.:.||..||.. || :||.:::::|...:..::.||.:.|:| |.........|
  Fly   243 PQRR----RVAQIYLHPLYNASLNY-HDIGLIQLNRPVEYTWFVRPVRLWPMN-DIPYGKLHTMG 301

  Fly   303 WGTQKFGGPHSNILMEVNLPVWKQSDCRSSFVQHVP----------DTAMCAGFPEGGQDSCQGD 357
            :|:..|..|.:|||.|::|.|.....|.||    :|          .:.:||...|..:|:||||
  Fly   302 YGSTGFAQPQTNILTELDLSVVPIEQCNSS----LPADEGSPHGLLTSQICAHDYEKNRDTCQGD 362

  Fly   358 SGGPLLVQLPNQ----------RWVTIGIVSWGVGCGQRGRPGIYTRVDRYLDWI 402
            |||||.:.|..:          |:..:||.|:|..| :...||:||||..|:|||
  Fly   363 SGGPLQLNLERRRRRHTSRKHYRYYLVGITSYGAYC-RSELPGVYTRVSSYIDWI 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 81/248 (33%)
Tryp_SPc 176..402 CDD:238113 81/248 (33%)
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 82/249 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.