DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and CG11668

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster


Alignment Length:379 Identity:98/379 - (25%)
Similarity:148/379 - (39%) Gaps:87/379 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 YGACST---PLGESGRCRHIIYCRMPELKNDVWRLVSQLCIIEKSSIGICC-------------- 131
            ||.|..   ||  .|:|...:.|  ......|.|:...||.....:..:||              
  Fly    41 YGNCQAHDRPL--IGKCVRYVDC--ISAMQAVPRVTPLLCPSSWPNQLVCCPHGGYLLPPPSISK 101

  Fly   132 TDQSTSNRF--------------SPQVVTSADGDEPRIVNKPEQRGCGITSRQFPRLTGGRPAEP 182
            ::|:.:|.:              :|: :...:..|| |:.|..|      |:..  |.|||..:.
  Fly   102 SEQACANAYPRAHHKRRRRRRNTNPK-LDQVELVEP-IIQKHNQ------SQNL--LVGGRLTQE 156

  Fly   183 DEWPWMAALLQEGLPFVW--------------CGGVLITDRHVLTAAHCIYKKNKEDIFVRLGEY 233
            :|.|:|.||........|              ||..:|..|..:|||||.....:......:|..
  Fly   157 NEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFAITAAHCASVGGESPSVALIGGV 221

  Fly   234 NTHMLNETRARDFRIANMVLHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCMPPVNEDWSDRNA 298
            .   ||..|.:...|..:..|..::.:...||:|:|::.|.:..     ||......|...:|..
  Fly   222 E---LNSGRGQLIEIKRISQHPHFDAETLTNDLAVVKLARRSHM-----PVACLWNQESLPERPL 278

  Fly   299 IVTGWGTQKFGGPHSNILMEVNLPVWKQSDCR------SSFVQHVPDTAMCAGFPEGGQDSCQGD 357
            ...|:|..||.||||:.|:::.|.......|:      ......:....||||...|..|:||||
  Fly   279 TALGYGQTKFAGPHSSNLLQIMLYHLNFQQCQRYLHNYDKLANGLGSGQMCAGDYSGNMDTCQGD 343

  Fly   358 SGGPLLVQ---------LPNQRWVTIGIVSWGVGCGQRGRPGIYTRVDRYLDWI 402
            ||||||:.         :|    ..:||.|:|..|.. |:||:|.|:..|:.||
  Fly   344 SGGPLLLHQHMRHHRHTIP----YVVGITSFGGACAS-GQPGVYVRIAHYIQWI 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829 12/61 (20%)
Tryp_SPc 173..402 CDD:214473 73/257 (28%)
Tryp_SPc 176..402 CDD:238113 72/254 (28%)
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 74/257 (29%)
Tryp_SPc 149..392 CDD:214473 72/255 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.