DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and CG6462

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster


Alignment Length:257 Identity:73/257 - (28%)
Similarity:117/257 - (45%) Gaps:48/257 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 RLTGGRPAEPDEWPWMAALLQE--GLPFVWCGGVLITDRHVLTAAHCIYKKNKEDIFVRLG---- 231
            |:.||..|....:|:...|:.:  |...|.|||.|||.:.|||||||:.......|:....    
  Fly    76 RIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATVFAD 140

  Fly   232 -EYNTHMLNETRARDFRIANMVLHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCMPPVNEDWSD 295
             |.:...|..|. |||     :::.||......:|:|::|:.|....:..:.|:   .:..::..
  Fly   141 VEDSVEELQVTH-RDF-----IIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPI---ELAGEFMH 196

  Fly   296 RNAIV------TGWG-----TQKFGGPHSNILMEVNLPVWKQSDCRSSFV-------QHVPDTAM 342
            :|.:|      :|||     |.|    .:.:|..::..|..|..|...|:       :|     :
  Fly   197 QNFLVGKVVTLSGWGYLGDSTDK----RTRLLQYLDAEVIDQERCICYFLPGLVSQRRH-----L 252

  Fly   343 CAGFPEGGQDSCQGDSGGPLLVQLPNQRWVTIGIVSWG--VGCGQRGRPGIYTRVDRYLDWI 402
            |.. ...|:.:|.||||||::....|..:: ||:.|:|  .|| :.|.|.:|||:..||.||
  Fly   253 CTD-GSNGRGACNGDSGGPVVYHWRNVSYL-IGVTSFGSAEGC-EVGGPTVYTRITAYLPWI 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 71/255 (28%)
Tryp_SPc 176..402 CDD:238113 70/252 (28%)
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 71/255 (28%)
Tryp_SPc 77..314 CDD:238113 72/256 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457734
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.