DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and mas

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_523919.1 Gene:mas / 38499 FlyBaseID:FBgn0011653 Length:1047 Species:Drosophila melanogaster


Alignment Length:384 Identity:111/384 - (28%)
Similarity:176/384 - (45%) Gaps:68/384 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RTGENRVVSFLSQHRLNKRQAPTSQLLE---------NKD-----YGACSTPLGESGRCRHIIYC 103
            |||.::.:||:|..|.......|::.:.         ||.     .|:...|:            
  Fly   689 RTGRSQALSFVSYARAKYGVQRTARQMTSAAGYSPNFNKSNERLVLGSAIVPI------------ 741

  Fly   104 RMPELKNDVWRLVSQLCIIEKSSIGICCTDQSTSNRFSPQVVTSADGDEPRIVNKPE---QRGC- 164
               ::.||  :|..   ::|.||:        .||:........|..|:|.:| .||   ||.. 
  Fly   742 ---QIHND--KLGD---LVESSSL--------QSNQLRSYHNHQAQADQPDLV-YPEYYQQRSLY 789

  Fly   165 GITS----RQFPRLTGGRPAEPDEWPWMAALLQEGLPFVWCGGVLITDRHVLTAAHCIYK--KNK 223
            |:.|    |:..|:.||...|..||.|..||: ..|....||..||..:.|||||||:..  ::.
  Fly   790 GLQSNFSGRRRARVVGGEDGENGEWCWQVALI-NSLNQYLCGAALIGTQWVLTAAHCVTNIVRSG 853

  Fly   224 EDIFVRLGEYN-THMLNETRARDFRIANMVLHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCMP 287
            :.|:||:|:|: |.......|:..|:|...:|.::|.|..|||||::::.........:..||:|
  Fly   854 DAIYVRVGDYDLTRKYGSPGAQTLRVATTYIHHNHNSQTLDNDIALLKLHGQAELRDGVCLVCLP 918

  Fly   288 PVN-EDWSDRNAIVTGWGTQKFGGPHSNILMEVNLPVWKQSDC--------RSSFVQHVPDTAMC 343
            ... ...:.:...|||:|.....||....:.|..:|:...::|        ...|:  :|.::.|
  Fly   919 ARGVSHAAGKRCTVTGYGYMGEAGPIPLRVREAEIPIVSDTECIRKVNAVTEKIFI--LPASSFC 981

  Fly   344 AGFPEGGQDSCQGDSGGPLLVQLPNQRWVTIGIVSWGVGCGQRGRPGIYTRVDRYLDWI 402
            || .|.|.|:||||.||||:.| .:..:...|:||||.|||::..||:|.:...::.||
  Fly   982 AG-GEEGHDACQGDGGGPLVCQ-DDGFYELAGLVSWGFGCGRQDVPGVYVKTSSFIGWI 1038

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829 7/44 (16%)
Tryp_SPc 173..402 CDD:214473 78/240 (33%)
Tryp_SPc 176..402 CDD:238113 77/237 (32%)
masNP_523919.1 Tryp_SPc 803..1041 CDD:238113 79/241 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.