DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and CG14990

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster


Alignment Length:331 Identity:93/331 - (28%)
Similarity:149/331 - (45%) Gaps:71/331 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 LKN---DVWRLVSQLCIIEKSSIGICCTDQSTSNRFSPQVVTSADGDEPRIVN--------KPE- 160
            |||   :.:.|||.||         ..|.|:             :|..|.|.|        :|: 
  Fly     2 LKNWTINTFLLVSFLC---------SATGQN-------------EGGAPGIFNGMSFTENLQPDP 44

  Fly   161 QRGCGITSRQFPRLTGGRPAE---------PDEWPWMAALLQEGLPFVWCGGVLITDRHVLTAAH 216
            .:.||:::      ..|..|.         |.::||:.||..:|..|  ..|.||....|||||.
  Fly    45 NQVCGMSN------PNGLVANVKVPKDYSTPGQFPWVVALFSQGKYF--GAGSLIAPEVVLTAAS 101

  Fly   217 CIYKKNKEDIFVRLGEYNTHMLNE-TRARDFRIANMVLHIDYNPQNYDNDIAIVRIDRATIFNTY 280
            .:..|...:|.||.||:||...:| ..:.|..:|.:|.|.:::.....|:||::.:.......::
  Fly   102 IVVGKTDAEIVVRAGEWNTGQRSEFLPSEDRPVARVVQHREFSYLLGANNIALLFLANPFELKSH 166

  Fly   281 IWPVCMPPVNEDWSDRNAIVTGWGTQKFGGP-HSNILMEVNLPVWKQSDCRS---------SFVQ 335
            |..:|:|.....:..:..:|||||...|... :|||..::.||:..::.|:.         ||  
  Fly   167 IRTICLPSQGRSFDQKRCLVTGWGKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSF-- 229

  Fly   336 HVPDTAMCAGFPEGGQDS--CQGDSGGPLL--VQLPNQRWVTIGIVSWGVGCGQRGRPGIYTRVD 396
            .:|.:.:|||   |.:|:  |.||.|..|.  ::....|:...|||:||:||.:...|.:||.|:
  Fly   230 DLPASLICAG---GEKDAGDCLGDGGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNVE 291

  Fly   397 RYLDWI 402
            .:.|||
  Fly   292 MFRDWI 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829 8/26 (31%)
Tryp_SPc 173..402 CDD:214473 74/252 (29%)
Tryp_SPc 176..402 CDD:238113 74/249 (30%)
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 74/238 (31%)
Tryp_SPc 67..297 CDD:214473 72/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457549
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.