DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and KLKB1

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_011530232.1 Gene:KLKB1 / 3818 HGNCID:6371 Length:649 Species:Homo sapiens


Alignment Length:423 Identity:123/423 - (29%)
Similarity:197/423 - (46%) Gaps:57/423 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PQSTIAKTVSTDFLDLLDFSDNDEFQWGESENQVYENRTGENRVVS-------FLSQHRL--NKR 71
            |.:.:.:|:.|...:.|.|:........||:..|...:|.|:...|       .:|.:.|  .||
Human   233 PDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKR 297

  Fly    72 QAPT---SQLLENKDYG-------------ACSTPLGESGRCRHIIYCRMPE-LKNDVWRLVSQL 119
            ..|.   |::....|:|             .|.....:..||:...|..:|| .|.:..:     
Human   298 TLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCK----- 357

  Fly   120 CIIEKSSIGICCTDQSTSNRFSPQVVTSADGDEPRIVNKPEQRGCGITSRQFPRLTGGRPAEPDE 184
            |.:..|..|     ..|...:..|   .:.|...|:.|..:...|  |::...|:.||..:...|
Human   358 CFLRLSMDG-----SPTRIAYGTQ---GSSGYSLRLCNTGDNSVC--TTKTSTRIVGGTNSSWGE 412

  Fly   185 WPWMAAL-----LQEGLPFVWCGGVLITDRHVLTAAHCIYKKNKEDIFVRLGEYNTHMLNETRAR 244
            |||..:|     .|..|    |||.||..:.|||||||......:|:: |:.....::.:.|:..
Human   413 WPWQVSLQVKLTAQRHL----CGGSLIGHQWVLTAAHCFDGLPLQDVW-RIYSGILNLSDITKDT 472

  Fly   245 DF-RIANMVLHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCMPPVNEDWSD--RNAIVTGWGTQ 306
            .| :|..:::|.:|.....::|||::::.....:..:..|:|:|. ..|.|.  .|..|||||..
Human   473 PFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPICLPS-KGDTSTIYTNCWVTGWGFS 536

  Fly   307 KFGGPHSNILMEVNLPVWKQSDCRSSFVQH-VPDTAMCAGFPEGGQDSCQGDSGGPLLVQLPNQR 370
            |..|...|||.:||:|:....:|:..:..: :....:|||:.|||:|:|:|||||||:.: .|..
Human   537 KEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCK-HNGM 600

  Fly   371 WVTIGIVSWGVGCGQRGRPGIYTRVDRYLDWIL 403
            |..:||.|||.||.:|.:||:||:|..|:||||
Human   601 WRLVGITSWGEGCARREQPGVYTKVAEYMDWIL 633

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829 10/45 (22%)
Tryp_SPc 173..402 CDD:214473 84/237 (35%)
Tryp_SPc 176..402 CDD:238113 83/234 (35%)
KLKB1XP_011530232.1 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 212..295 CDD:128519 13/61 (21%)
APPLE 303..386 CDD:128519 17/95 (18%)
Tryp_SPc 401..632 CDD:214473 84/237 (35%)
Tryp_SPc 402..632 CDD:238113 83/236 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42230
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.