DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and CG30414

DIOPT Version :10

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_611789.2 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:59 Identity:14/59 - (23%)
Similarity:23/59 - (38%) Gaps:4/59 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FTASLVSYLTSPSLVSLNHLPPSFFLPTKLVKPTSLTHSQPPRLSA-SYGPAAKAATAN 60
            |:.::...:....|.|:..:||   .|....||.:....:|...:| |.|...|....|
  Fly    41 FSQTVYILIAGVLLASILTIPP---WPIYRKKPLNWQKPRPDSQTAQSAGDETKKKKKN 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473
CG30414NP_611789.2 Tryp_SPc 41..290 CDD:238113 14/59 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.