DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and tpr

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster


Alignment Length:412 Identity:141/412 - (34%)
Similarity:195/412 - (47%) Gaps:71/412 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KAFLWALVIL-LGYIPQSTIAK---TVSTDFLDLLDFSDNDEFQWGESENQVYENRTGENRVVSF 62
            :|:|..|:.| |...|..:.::   |..|....||..|.|...||                |:|.
  Fly     3 RAWLCLLICLALSCGPSQSASQDRATNQTAASPLLKQSQNTFIQW----------------VLSL 51

  Fly    63 LSQHRLNKRQAPTSQLLENKDYGACSTPLGESGRCRHIIYCRMPELKNDVWRLVSQLCIIEKSSI 127
            |.|.       |.|...||......|:.            ..||:..:                 
  Fly    52 LPQR-------PGSSDSENATLATLSSS------------SMMPDAAS----------------- 80

  Fly   128 GICCTDQSTSNRFSPQVVTS--ADGDEPRIVNKPEQRG---CGITSRQFPRLTGGRPAEPDEWPW 187
                |..:|:...|....|:  |....|..:|.|....   |||.:.| .|:.||:..|..::||
  Fly    81 ----TTSTTTPAPSSSTTTTRRATTPAPPTLNPPRNCSDCVCGIANIQ-KRIVGGQETEVHQYPW 140

  Fly   188 MAALLQEGLPFVWCGGVLITDRHVLTAAHCIYKKNKEDIFVRLGEYNTHMLNETRARDFRIANMV 252
            :|.||..|.  .:|...|:.|:.:|||:||:|...||.|.|||.|::..| :..:..|.::|.::
  Fly   141 VAMLLYGGR--FYCAASLLNDQFLLTASHCVYGFRKERISVRLLEHDRKM-SHMQKIDRKVAEVI 202

  Fly   253 LHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCMPPVNEDWSDRNAIVTGWGTQKFGGPHSNILM 317
            .|..||.:||||||||:::|....||..:.|||||.....:...|.||||||..|.|||.|:.|.
  Fly   203 THPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSFKGENGIVTGWGALKVGGPTSDTLQ 267

  Fly   318 EVNLPVWKQSDCRSS-FVQHVPDTAMCAGFPEGGQDSCQGDSGGPLLVQLPNQRWVTI-GIVSWG 380
            ||.:|:..|.:||.| :...:.|..:|.|:.|||:|||||||||||.:.....|...| |:||||
  Fly   268 EVQVPILSQDECRKSRYGNKITDNMLCGGYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWG 332

  Fly   381 VGCGQRGRPGIYTRVDRYLDWI 402
            .||.:.|.||:|.||:||..||
  Fly   333 EGCAKAGYPGVYARVNRYGTWI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829 3/44 (7%)
Tryp_SPc 173..402 CDD:214473 102/230 (44%)
Tryp_SPc 176..402 CDD:238113 101/227 (44%)
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 102/230 (44%)
Tryp_SPc 127..356 CDD:238113 103/231 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457741
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I2933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42230
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
65.890

Return to query results.
Submit another query.