DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and CG8172

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster


Alignment Length:257 Identity:93/257 - (36%)
Similarity:146/257 - (56%) Gaps:17/257 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 GCGITSRQFPRLTGGRPAEPDEWPWMAALLQEGLPFVW----CGGVLITDRHVLTAAHCIYKKNK 223
            |||....:..|:.||........||..||::.|  |:.    |||.||::|.|:|||||:.....
  Fly   305 GCGEVYTRSNRIVGGHSTGFGSHPWQVALIKSG--FLTRKLSCGGALISNRWVITAAHCVASTPN 367

  Fly   224 EDIFVRLGEYNTHMLNE-TRARDFRIANMVLHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCMP 287
            .::.:||||::.....| ....::.|....:|..|||.::.||:|::|:||..::..:|.|||:|
  Fly   368 SNMKIRLGEWDVRGQEERLNHEEYGIERKEVHPHYNPADFVNDVALIRLDRNVVYKQHIIPVCLP 432

  Fly   288 PVNEDWSDRNAIVTGWGTQKFG-GPHSNILMEVNLPVWKQSDCRSSF-----VQHVPDTAMCAGF 346
            |.....:.:.|.|.|||..:.| ....::|.||::.|.....|:..|     .:.:.|..:|||:
  Fly   433 PSTTKLTGKMATVAGWGRTRHGQSTVPSVLQEVDVEVISNDRCQRWFRAAGRREAIHDVFLCAGY 497

  Fly   347 PEGGQDSCQGDSGGPLLVQLPNQRWVTIGIVSWGVGCGQRGRPGIYTRVDRYLDWI---LAN 405
            .:||:|||||||||||.:.:..:: ..||:||||:|||:...||:||.:.|::.||   :||
  Fly   498 KDGGRDSCQGDSGGPLTLTMDGRK-TLIGLVSWGIGCGREHLPGVYTNIQRFVPWINKVMAN 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 86/239 (36%)
Tryp_SPc 176..402 CDD:238113 85/236 (36%)
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 86/239 (36%)
Tryp_SPc 316..555 CDD:238113 87/241 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442201
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.