DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and CG4793

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster


Alignment Length:263 Identity:86/263 - (32%)
Similarity:135/263 - (51%) Gaps:23/263 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 NKPEQRGCGITSR---QFPRLTGGRP-AEPDEWPWMAALLQEGLPFVWCGGVLITDRHVLTAAHC 217
            |:|....||..:|   .| .:|..|. |:..|.|||.|||.........||.|||...|||::..
  Fly    79 NQPLPTECGHVNRIGVGF-TITNARDIAQKGELPWMVALLDSRSRLPLGGGSLITRDVVLTSSTK 142

  Fly   218 IYKKNKEDIFVRLGEYNTHMLNETRA-RDFRIANMVLHIDYNPQNYDNDIAIVRIDRATIFNTYI 281
            ..:..::.:.||.||::...:.|.|| .|..|..:|.|.:.:.:|..|:.|::.:.|....:.:|
  Fly   143 TLEVPEKYLIVRAGEWDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHI 207

  Fly   282 WPVCMPPVNEDWSDRNAIVTGWGTQ-KFGGPHSNILMEVNLPVWKQSDCRS--------SFVQHV 337
            ..:|:||.|.::.....||:|||.: .....:.|||.::.||:..:|.|::        .|:  :
  Fly   208 GLICLPPPNRNFIHNRCIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFI--L 270

  Fly   338 PDTAMCAGFPEGGQDSCQGDSGGPLLVQL---PNQRWVTIGIVSWGVGCGQRGRPGIYTRVDRYL 399
            .::.:||| .|.|:|:|:||.|.||...|   || |:..:|||::|.||| ...|..||.|.:..
  Fly   271 DNSLICAG-GEPGKDTCKGDGGAPLACPLQSDPN-RYELLGIVNFGFGCG-GPLPAAYTDVSQIR 332

  Fly   400 DWI 402
            .||
  Fly   333 SWI 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 78/242 (32%)
Tryp_SPc 176..402 CDD:238113 77/239 (32%)
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 78/236 (33%)
Tryp_SPc 105..335 CDD:214473 76/234 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457553
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.