DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and CG5390

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster


Alignment Length:309 Identity:101/309 - (32%)
Similarity:154/309 - (49%) Gaps:43/309 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 KSSIGICCTDQSTSNRFSPQVVTSADGDEPRIVNKPEQ-RGCGITSRQFP-----RLTG--GRPA 180
            |:.:.:|| |.....:            :|....||:. .|||.   |.|     ::||  .:.|
  Fly   107 KNYLDLCC-DLPNKRK------------DPIFEFKPDHPEGCGY---QNPNGVGFKITGAVNQEA 155

  Fly   181 EPDEWPWMAALLQE--GLPFVWCGGVLITDRHVLTAAHCIYKKNKEDIFVRLGEYNTHMLNETRA 243
            |..|:|||.|:|:|  .|....|||.||....|||||||::.|....|.||.||::|....|.|.
  Fly   156 EFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEWDTQTQTEIRR 220

  Fly   244 RDFR-IANMVLHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCMPPVNEDWSDRNAIVTGWGTQK 307
            .:.| :..::.|..:|..:..||:|::.::........|..||:|.|.:.:.......||||..|
  Fly   221 HEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKFDFDRCYATGWGKNK 285

  Fly   308 FG--GPHSNILMEVNLPVWKQSDCRSS---------FVQHVPDTAMCAGFPEGGQDSCQGDSGGP 361
            ||  |.:..||.:|::||..:..|.::         |:.|  |:.:||| .|..:|:|:||.|.|
  Fly   286 FGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILH--DSFICAG-GEKDKDTCKGDGGSP 347

  Fly   362 LLVQLPNQ--RWVTIGIVSWGVGCGQRGRPGIYTRVDRYLDWILANADV 408
            |:..:..|  |:.:.|||:||:|||:...||:|..|.:...||.|...:
  Fly   348 LVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWIDAKLKI 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829 2/7 (29%)
Tryp_SPc 173..402 CDD:214473 86/246 (35%)
Tryp_SPc 176..402 CDD:238113 85/243 (35%)
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 85/240 (35%)
Tryp_SPc 153..390 CDD:214473 84/239 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457433
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.