DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and CG3355

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster


Alignment Length:286 Identity:102/286 - (35%)
Similarity:161/286 - (56%) Gaps:22/286 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 QSTSNRFSPQVVTSADGDEPRI--VNKPEQRG---------CGITSRQFPRLTGGRPAEPDEWPW 187
            |:.:.:|: .||...|..|..|  |..|:.|.         ||  :....|:.||:....:::||
  Fly    28 QTLAQQFA-DVVDVVDPAEQSIKAVRPPKSRNQCTAKQNCFCG--TPNVNRIVGGQQVRSNKYPW 89

  Fly   188 MAALLQ-EGLPFVWCGGVLITDRHVLTAAHCIYKKNKEDIFVRLGEYNTHMLNETRARDFRIANM 251
            .|.|:: ...|.::|||.||.||:|||||||:: .|::.|.:||.:.:....:....|  ::...
  Fly    90 TAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVH-GNRDQITIRLLQIDRSSRDPGIVR--KVVQT 151

  Fly   252 VLHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCMPPVNEDWSDRNAIVTGWGTQKFGGPHSNIL 316
            .:|.:|:|....||:|:::::........:.|||:|..|.::..:.|:|.|||..|.||..||.|
  Fly   152 TVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNFDGKTAVVAGWGLIKEGGVTSNYL 216

  Fly   317 MEVNLPVWKQSDCRSS-FVQHVPDTAMCAGF-PEGGQDSCQGDSGGPLLVQLPNQRWVTIGIVSW 379
            .|||:||...:.||.: :...:.:..:|||. .:||:|:|||||||||:|.  ..|:...|:||:
  Fly   217 QEVNVPVITNAQCRQTRYKDKIAEVMLCAGLVQQGGKDACQGDSGGPLIVN--EGRYKLAGVVSF 279

  Fly   380 GVGCGQRGRPGIYTRVDRYLDWILAN 405
            |.||.|:..||:|.||.::||||..|
  Fly   280 GYGCAQKNAPGVYARVSKFLDWIRKN 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 87/231 (38%)
Tryp_SPc 176..402 CDD:238113 86/228 (38%)
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 87/231 (38%)
Tryp_SPc 76..305 CDD:238113 88/233 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457742
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I2933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42230
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
65.890

Return to query results.
Submit another query.