DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and prss60.3

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:248 Identity:96/248 - (38%)
Similarity:128/248 - (51%) Gaps:17/248 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 CGITSRQFP---RLTGGRPAEPDEWPWMAALLQEGLPFVWCGGVLITDRHVLTAAHCIYKKNKED 225
            ||    |.|   |:.||..|.|..|||..:|........:|||.||:...|||||||:...::..
Zfish    27 CG----QAPLNTRIVGGVNASPGSWPWQVSLHSPKYGGHFCGGSLISSEWVLTAAHCLSGVSETT 87

  Fly   226 IFVRLGEYNTHMLN--ETRARDFRIANMVLHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCMPP 288
            :.|.||......:|  ||..   .:|...:|..||....|||||::|:..|..|..||.|||:..
Zfish    88 LVVYLGRRTQQGINIYETSR---NVAKSFVHSSYNSNTNDNDIALLRLSSAVTFTNYIRPVCLAA 149

  Fly   289 VNEDWS-DRNAIVTGWGTQKFGG--PHSNILMEVNLPVWKQSDCRSSFVQ-HVPDTAMCAGFPEG 349
            .|..:| ..::.:||||..:.|.  |...||.|..:||.....|.:.... .|.:..:|||..:|
Zfish   150 QNSVYSAGTSSWITGWGDIQAGVNLPAPGILQETMIPVVANDRCNALLGSGTVTNNMICAGLTQG 214

  Fly   350 GQDSCQGDSGGPLLVQLPNQRWVTIGIVSWGVGCGQRGRPGIYTRVDRYLDWI 402
            |:|:||||||||::.:|... ||..||.|||.||.....||:||||.:|..||
Zfish   215 GKDTCQGDSGGPMVTRLCTV-WVQAGITSWGYGCADPNSPGVYTRVSQYQSWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 90/234 (38%)
Tryp_SPc 176..402 CDD:238113 89/231 (39%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 91/235 (39%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587668
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.