DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and CG18557

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster


Alignment Length:330 Identity:90/330 - (27%)
Similarity:147/330 - (44%) Gaps:37/330 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 RHIIYCRMPELKNDVWRL--VSQLCIIEKSSI--GICCTDQSTSNRFS-PQVVTSAD----GDEP 153
            |.:|:.|.     ..|.|  ....|.::...:  |:|.|.....|..| |.....::    ..:.
  Fly     3 RRVIFIRC-----CFWTLTETGAPCGLQMECVPQGLCKTSAWNQNAISWPSPCQRSESCCHSSQK 62

  Fly   154 RIVNKPEQRGCGITSRQFPRLTGGR------PAEPDEWPWMAALLQEGLPFVWCGGVLITDRHVL 212
            .::..|  ..||   :..|...||.      .|:|:|:||..||:|..:.| :..|.|:|:..|:
  Fly    63 LVIGAP--LNCG---KSNPNGLGGTVEEVVDQAKPNEFPWTVALMQNLINF-FGAGTLVTENIVI 121

  Fly   213 TAAHCIYKKNKEDIFVRLGEYNTHMLNETRARDFRIANMVLHIDYNPQNYDNDIAIVRIDRATIF 277
            ||||.:..|...|..:..|.::...|.....:......:|.|.|:|.....|:||::.::.:.:.
  Fly   122 TAAHLMLDKTINDFGIIGGAWDLKQLAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVM 186

  Fly   278 NTYIWPVCMPPVNEDWSDRNAIVTGWGTQKF-GGPHSNILMEVNLPVWKQSDC-----RSSFVQ- 335
            ...|.|:|.|.....:.....:|.|||...| ...:|....:::||:..:|||     |::||| 
  Fly   187 KPPIGPICWPTSGVSFDRERCLVAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQS 251

  Fly   336 -HVPDTAMCAGFPEGGQDSCQGDSGGPLLVQLPNQR--WVTIGIVSWGVGCGQRGRPGIYTRVDR 397
             .:..|.:||| .|.|:|:|.||.|.||:..:|...  :..:|||:.|..||....|.:||.:..
  Fly   252 FQLDPTILCAG-GERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISH 315

  Fly   398 YLDWI 402
            ...||
  Fly   316 MRPWI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829 8/37 (22%)
Tryp_SPc 173..402 CDD:214473 72/244 (30%)
Tryp_SPc 176..402 CDD:238113 72/241 (30%)
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 72/235 (31%)
Tryp_SPc 90..320 CDD:214473 70/231 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457559
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.