DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and CG32523

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster


Alignment Length:244 Identity:70/244 - (28%)
Similarity:115/244 - (47%) Gaps:27/244 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 PRLTGGRPAEPDEWPWMAALLQEGLPFVWCGGVLITDRHVLTAAHCIYKKNKEDIF------VRL 230
            ||:.||..|:..::|...:|...|..:  ||||:|:..||:||.||:  |:..|:.      ::.
  Fly    35 PRIVGGIKAKQGQFPHQISLRLRGEHY--CGGVIISATHVITAGHCV--KHGNDVVPADLWSIQA 95

  Fly   231 GEYNTHMLNETRARDFRIANMVLHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCMPPVNEDWSD 295
            |..   :|:....| ..:|.:::|.:|....: ||:|::|:.....|:..|..:.:  ..||..:
  Fly    96 GSL---LLSSDGVR-IPVAEVIMHPNYATGGH-NDLAVLRLQSPLTFDANIAAIQL--ATEDPPN 153

  Fly   296 RNAI-VTGWGTQKFGGPHSNILMEVNLPVWKQSDCRSSFVQHVPDTAMCAGFPEGGQDSCQGDSG 359
            ..|: ::|||.....||.|:.|:.|.:....:..||..|...:|:|.:|. .......:|.||||
  Fly   154 CVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYSRLPETMICL-LHSKNSGACYGDSG 217

  Fly   360 GPLLVQLPNQRWVTIGIVS--WGVGCGQRGRPGIYTRVDRYLDWILANA 406
            ||     .......:|:.|  .|.||| |..|..|.|:.:...||...|
  Fly   218 GP-----ATYGGKVVGLASLLLGGGCG-RAAPDGYLRISKVRAWIAEKA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 66/237 (28%)
Tryp_SPc 176..402 CDD:238113 65/234 (28%)
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 66/237 (28%)
Tryp_SPc 37..219 CDD:238113 53/193 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457733
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.