DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and CG32376

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:237 Identity:72/237 - (30%)
Similarity:107/237 - (45%) Gaps:19/237 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 FP-RLTGGRPAEPDEWPWMAALLQEGLPFVWCGGVLITDRHVLTAAHCIYKKNKEDIFVRLGEYN 234
            || |:..|:.....|.|:..:|..||. || ||.|:|....:|||.||.:.. .|...||:|...
  Fly    62 FPTRIVNGKRIPCTEAPFQGSLHYEGY-FV-CGCVIINKIWILTAHHCFFGP-PEKYTVRVGSDQ 123

  Fly   235 THMLNETRARDFRIANMVLHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCMPPVNEDWSDRNAI 299
            .....:.|    .:..:|....||.....:|:|::::.....|...:.||.:|........:..:
  Fly   124 QRRGGQLR----HVKKIVALAAYNDYTMRHDLAMMKLKSPVYFGKCVRPVKLPSTKTTKFPKKFV 184

  Fly   300 VTGWGTQKFGGPH-SNILMEVNLPVWKQSDCRSSFVQ---HVPDTAMCAGFPEGGQDSCQGDSGG 360
            |:|||.......: ...|..|.:...|:|.|:..:.:   .:....:||.  ...:|||.|||||
  Fly   185 VSGWGITSANAQNVQRYLRRVQIDYIKRSKCQKMYKKAGLKIYKDMICAS--RTNKDSCSGDSGG 247

  Fly   361 PLLVQLPNQRWVTIGIVSWGVGCGQRGRPGIYTRVDRYLDWI 402
            ||     ..|.|..||||||:||..:..||:|....||:.||
  Fly   248 PL-----TSRGVLYGIVSWGIGCANKNYPGVYVNCKRYVPWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 68/232 (29%)
Tryp_SPc 176..402 CDD:238113 67/229 (29%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 68/232 (29%)
Tryp_SPc 66..287 CDD:238113 69/233 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457753
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.