DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and Tmprss3

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_038954650.1 Gene:Tmprss3 / 309665 RGDID:1310135 Length:454 Species:Rattus norvegicus


Alignment Length:249 Identity:83/249 - (33%)
Similarity:135/249 - (54%) Gaps:21/249 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 CGITSRQFPRLTGGRPAEPDEWPWMAALLQEGLPFVWCGGVLITDRHVLTAAHCIYKKNKEDIF- 227
            ||:.:...||:.||..:...:|||..:|..:|  :..|||.:||...::|||||:|     |:: 
  Rat   207 CGMRTGYSPRIVGGNVSSLTQWPWQVSLQFQG--YHLCGGSVITPLWIVTAAHCVY-----DLYH 264

  Fly   228 -----VRLGEYNTHMLNETRARDFRIANMVLHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCMP 287
                 |::|..:   |.::......:..::.|..|.|:...||||::::.....|:..|.|:|:|
  Rat   265 PKSWTVQVGLVS---LMDSPVPSHLVEKIIYHSKYKPKRLGNDIALMKLSEPLTFDETIQPICLP 326

  Fly   288 PVNEDWSDRNAIVT-GWG-TQKFGGPHSNILMEVNLPVWKQSDC--RSSFVQHVPDTAMCAGFPE 348
            ...|::.|.....| ||| |:...|..|.:|....:|:.....|  |..:...:..:.:|||:.:
  Rat   327 NSEENFPDGKLCWTSGWGATEDGAGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGYLK 391

  Fly   349 GGQDSCQGDSGGPLLVQLPNQRWVTIGIVSWGVGCGQRGRPGIYTRVDRYLDWI 402
            ||.|||||||||||:.| ..:.|..:|..|:|:||.:..:||:|||:..:||||
  Rat   392 GGVDSCQGDSGGPLVCQ-ERRLWKLVGATSFGIGCAEVNKPGVYTRITSFLDWI 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 78/238 (33%)
Tryp_SPc 176..402 CDD:238113 77/235 (33%)
Tmprss3XP_038954650.1 LDLa 74..107 CDD:238060
SRCR_2 112..211 CDD:406055 2/3 (67%)
Tryp_SPc 216..444 CDD:214473 78/238 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45531
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.