DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and Hpn

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_038958880.1 Gene:Hpn / 29135 RGDID:61982 Length:559 Species:Rattus norvegicus


Alignment Length:302 Identity:93/302 - (30%)
Similarity:135/302 - (44%) Gaps:44/302 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 GICCTDQS---TSNRFSPQVVTSADGDEPRIVNKPEQRGCGITSRQFPRLTGGRPAEPDEWPWMA 189
            |..|.|:.   .:.|.. .|::..|....|.:....| .||.......|:.||:.:....|||..
  Rat   157 GFFCVDEGGLPLAQRLL-DVISVCDCPRGRFLTATCQ-DCGRRKLP
VDRIVGGQDSSLGRWPWQV 219

  Fly   190 ALLQEGLPFVWCGGVLITDRHVLTAAHCIYKKNKEDIFVRLGEYNTHMLNETR------------ 242
            :|..:|...  |||.|::...|||||||..::|:             :|:..|            
  Rat   220 SLRYDGTHL--CGGSLLSGDWVLTAAHCFPERNR-------------VLSRWRVFAGAVARTSPH 269

  Fly   243 ARDFRIANMVLHIDYNP------QNYDNDIAIVRIDRATIFNTYIWPVCMPPVNEDWSD-RNAIV 300
            |....:..::.|..|.|      ....||||:|.:..:.....||.|||:|...:...| :...|
  Rat   270 AVQLGVQAVIYHGGYLPFRDPTIDENSNDIALVHLSSSLPLTEYIQPVCLPAAGQALVDGKVCTV 334

  Fly   301 TGWGTQKFGGPHSNILMEVNLPVWKQSDCRSS--FVQHVPDTAMCAGFPEGGQDSCQGDSGGPLL 363
            ||||..:|.|..:.:|.|..:|:.....|.|.  :...:.....|||:||||.|:||||||||.:
  Rat   335 TGWGNTQFYGQQAVVLQEARVPIISNEVCNSPDFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFV 399

  Fly   364 VQ---LPNQRWVTIGIVSWGVGCGQRGRPGIYTRVDRYLDWI 402
            .:   ....||...||||||.||....:||:||:|..:.:||
  Rat   400 CEDRISGTSRWRLCGIVSWGTGCALARKPGVYTKVIDFREWI 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829 1/3 (33%)
Tryp_SPc 173..402 CDD:214473 81/252 (32%)
Tryp_SPc 176..402 CDD:238113 80/249 (32%)
HpnXP_038958880.1 Hepsin-SRCR 92..200 CDD:401275 10/44 (23%)
Tryp_SPc 204..441 CDD:238113 80/251 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12330
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.