DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and F11

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_006253206.1 Gene:F11 / 290757 RGDID:1309364 Length:622 Species:Rattus norvegicus


Alignment Length:376 Identity:121/376 - (32%)
Similarity:182/376 - (48%) Gaps:65/376 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LLENKDYGACSTPLGESG--------RCRHII--YCRMPELKNDVWRLVSQLCIIE---KSSIGI 129
            ||:..:.|..||.:.:|.        .|||.|  :|. |...||...|..:|.|::   |.|...
  Rat   256 LLKTSESGFPSTRITKSNALSGFSLQHCRHSIPVFCH-PNFYNDTDFLGEELDIVDVKGKESCQK 319

  Fly   130 CCTDQSTSNRFS--PQ------------VVTSADGDEPRIVNKPEQRGCGI-------------- 166
            .|:|......|:  |.            :..|::|...||::   .|| ||              
  Rat   320 MCSDNVRCQFFTYYPSRGSCSERKGRCYLKLSSNGSPTRILH---GRG-GISGYTLRLCKMDNVC 380

  Fly   167 TSRQFPRLTGGRPAEPDEWPWMAAL--LQEGLPFVWCGGVLITDRHVLTAAHCIY-KKNKEDIFV 228
            |::..||:.||..:...||||...|  .|..|    |||.:|.:|.:||||||.. .:..:.:.|
  Rat   381 TTKIRPRVFGGAASVHGEWPWQVTLHTTQGHL----CGGSIIGNRWILTAAHCFSGTETPKTLRV 441

  Fly   229 RLGEYNTHMLNETRARDFRIANMVLHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCMPPVNEDW 293
            ..|..|...:||. ...||:..|::|..|.......|||:::::.|..:..:..|:|:|    ..
  Rat   442 YGGIVNQSEINED-TTFFRVQEMIIHDQYTSAESGFDIALLKLEPAMNYTDFQRPICLP----SK 501

  Fly   294 SDRNAI-----VTGWGTQKFGGPHSNILMEVNLPVWKQSDCRSSFVQH-VPDTAMCAGFPEGGQD 352
            .|||.:     |||||..|......:.|.:..:|:....:|::.:.:| :.:..:|||:.|||:|
  Rat   502 GDRNVVHTECWVTGWGYTKSRDEVQSTLQKAKVPLVSNEECQTRYRKHKITNKVICAGYKEGGKD 566

  Fly   353 SCQGDSGGPLLVQLPNQRWVTIGIVSWGVGCGQRGRPGIYTRVDRYLDWIL 403
            :|:|||||||..: .|..|..:||.|||.||||:.|||:||.|.:|:||||
  Rat   567 TCKGDSGGPLSCK-HNGVWHLVGITSWGEGCGQKERPGVYTNVAKYVDWIL 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829 16/57 (28%)
Tryp_SPc 173..402 CDD:214473 85/237 (36%)
Tryp_SPc 176..402 CDD:238113 84/234 (36%)
F11XP_006253206.1 APPLE 20..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519 6/26 (23%)
APPLE 291..374 CDD:128519 21/87 (24%)
Tryp_SPc 387..615 CDD:214473 85/237 (36%)
Tryp_SPc 388..615 CDD:238113 84/236 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I4132
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.