DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and Prss29

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:256 Identity:72/256 - (28%)
Similarity:123/256 - (48%) Gaps:42/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 LTGGRPAEPDEWPWMAALLQEGLPFVW------CGGVLITDRHVLTAAHCIYKKNKEDIFVR--L 230
            :.||..|...:|||..:|  ....:.|      |||.:|..:.||||||||::.:.:....|  |
  Rat    31 IVGGNSAPQGKWPWQVSL--RVYRYNWASWVHICGGSIIHPQWVLTAAHCIHESDADPSAFRIYL 93

  Fly   231 GE---YNTHMLNETRARDFRIANMVLHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCMPPVNED 292
            |:   |....|       .:::.:::|.|:......:|:|::::.::......:.||.:.|.:.:
  Rat    94 GQVYLYGGEKL-------LKVSRVIIHPDFVRSGLGSDVALLQLAQSVRSFPNVKPVKLSPASLE 151

  Fly   293 WSDRNAI-VTGWGTQKFGGPHSNI-----LMEVNLPVWKQSDCRSSF------VQH----VPDTA 341
            .:.::.. |||||:...   |.::     |.:|.:.:...:.|...:      ..|    :....
  Rat   152 VTKKDVCWVTGWGSVSM---HESLPPPYRLQQVQVKIVDNTLCEKLYRNATRLSNHGQRLILQDM 213

  Fly   342 MCAGFPEGGQDSCQGDSGGPLLVQLPNQRWVTIGIVSWGVGCGQRGRPGIYTRVDRYLDWI 402
            :|||  ..|:|||.|||||||:..:... |..:|:||||.||..:..||:|.||..:|.||
  Rat   214 LCAG--SHGRDSCYGDSGGPLVCNVTGS-WTLVGVVSWGYGCALKDIPGVYARVQFFLPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 70/254 (28%)
Tryp_SPc 176..402 CDD:238113 70/252 (28%)
Prss29XP_017453326.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346443
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.