DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and LOC286960

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_775423.1 Gene:LOC286960 / 286960 RGDID:708585 Length:247 Species:Rattus norvegicus


Alignment Length:237 Identity:88/237 - (37%)
Similarity:129/237 - (54%) Gaps:17/237 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 RLTGGRPAEPDEWPWMAALLQEGLPFVWCGGVLITDRHVLTAAHCIYKKNKEDIFVRLGEYNTHM 237
            ::.||........|:..: |.:|:.. .|||.||:|:.||:|||| ||:..:   |||||:|.|:
  Rat    23 KIVGGYTCPKHLVPYQVS-LHDGISH-QCGGSLISDQWVLSAAHC-YKRKLQ---VRLGEHNIHV 81

  Fly   238 LNETRARDFRIANMVLHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCMPPVNEDWSDRNAIVTG 302
            | |...:......::.|.:||....||||.::::....:.|:.:..|.:|..... :|...:|:|
  Rat    82 L-EGGEQFIDAEKIIRHPEYNKDTLDNDIMLIKLKSPAVLNSQVSTVSLPRSCAS-TDAQCLVSG 144

  Fly   303 WG-TQKFGGPHSNILMEVNLPVWKQSDCRSSFVQHVPDTAMCAGFPEGGQDSCQGDSGGPLLVQL 366
            || |...||.:..:|..:..||...|.|:.|:...:.....|.||.|||:|||.||||||::...
  Rat   145 WGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQITSNMFCLGFLEGGKDSCDGDSGGPVVCNG 209

  Fly   367 PNQRWVTIGIVSWGVGCGQRGRPGIYTRVDRYLDWI---LAN 405
            ..|     ||||||..|..||:||:||:|..||.||   :||
  Rat   210 EIQ-----GIVSWGSVCAMRGKPGVYTKVCNYLSWIQETMAN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 84/229 (37%)
Tryp_SPc 176..402 CDD:238113 84/226 (37%)
LOC286960NP_775423.1 Tryp_SPc 23..240 CDD:214473 84/229 (37%)
Tryp_SPc 24..243 CDD:238113 86/231 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H77258
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.