DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and Sp212

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:373 Identity:96/373 - (25%)
Similarity:144/373 - (38%) Gaps:108/373 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 NDVWRLVSQLCIIEKSSIGICCTDQSTSNRFSPQVVTSAD------------------------- 149
            ||:||             |......:.||| ||.|||.|.                         
  Fly   173 NDIWR-------------GFTQPWTTVSNR-SPAVVTPAPTPTEIFWNQPVPSVPITFAPPVPTI 223

  Fly   150 --------------GDEPRIV-----NKPEQR----------GCGITSRQFPRLTGGRPAEPDEW 185
                          ...|.:|     ..|.||          .||......|.:..|......::
  Fly   224 TSSPAPAPPPPPPLPTPPAVVTVPPATPPPQRFDPRSQISSVVCGREGSTTPFIVRGNEFPRGQY 288

  Fly   186 PWMAALLQE---GLPFVWCGGVLITDRHVLTAAHCIYKKNKEDIFVRLGEYNTHMLNETRARDFR 247
            ||::|:..:   .|.|. |.|.||:...|::||||:::..::.:.|.||.|:.....|..|....
  Fly   289 PWLSAVYHKEVRALAFK-CRGSLISSSIVISAAHCVHRMTEDRVVVGLGRYDLDDYGEDGAEMRN 352

  Fly   248 IANMVLHIDYNPQNY-DNDIAIVRIDRATIFNTYIWPVCMPPVNEDWS-------DRNAIVTGWG 304
            :..::.|.|||.::| |.|||::.|:|...||..|.|:||      |:       .....:.|||
  Fly   353 VMRLLWHPDYNTRSYSDADIALITIERPVTFNDIIAPICM------WTVEASRTVSTTGFIAGWG 411

  Fly   305 TQKFGG----PHSNILMEVNLPVWKQSDCRSSFVQHVPDTAMCAGFPEGGQDSCQGDSGGPLLVQ 365
            ..:...    |.. :..|:..|....|..|.:.   |.:.::||| ...|...|.|||||.|:|:
  Fly   412 RDEDSSRTQYPRV-VEAEIASPTVCASTWRGTM---VTERSLCAG-NRDGSGPCVGDSGGGLMVK 471

  Fly   366 LPNQRWVTIGIVSWGVGCGQRGRPG--------IYTRVDRYLDWILAN 405
             ...||:..||||    .|:||..|        :|..:.::::||..|
  Fly   472 -QGDRWLLRGIVS----AGERGPAGTCQLNQYVLYCDLSKHINWISEN 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829 5/21 (24%)
Tryp_SPc 173..402 CDD:214473 71/251 (28%)
Tryp_SPc 176..402 CDD:238113 71/248 (29%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 73/253 (29%)
Tryp_SPc 277..511 CDD:214473 71/250 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.