DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and Tpsg1

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:276 Identity:97/276 - (35%)
Similarity:125/276 - (45%) Gaps:37/276 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 SADGDEP-RIVNKPEQ-RGCG--ITSRQFPRLTGGRPAEPDEWPWMAALLQEGLPFVWCGGVLIT 207
            ||.|..| .:.|.... .|||  ..|....|:.||..|....|||.|:|....:..  |||.|::
Mouse    56 SARGQYPDSLANSVSSGSGCGHPQVSNSGSRIVGGHAAPAGTWPWQASLRLHKVHV--CGGSLLS 118

  Fly   208 DRHVLTAAHCIY-KKNKEDIFVRLGEYNTHMLNETRARDFRIANMVLHIDY----NPQNYDNDIA 267
            ...|||||||.. ..|..|..|.|||     |..|.:..|.....:  |.|    .|.....|||
Mouse   119 PEWVLTAAHCFSGSVNSSDYQVHLGE-----LTVTLSPHFSTVKRI--IMYTGSPGPPGSSGDIA 176

  Fly   268 IVRIDRATIFNTYIWPVCMPPVNED-WSDRNAIVTGWGTQKFGGPHS---NILMEVNLPVWKQSD 328
            :|::......::.:.|||:|..:.| :......|||||....|.|..   | |.|..:.|.....
Mouse   177 LVQLSSPVALSSQVQPVCLPEASADFYPGMQCWVTGWGYTGEGEPLKPPYN-LQEAKVSVVDVKT 240

  Fly   329 C-------RSSFVQHVPDTAMCAGFPEGGQDSCQGDSGGPLLVQLPNQRWVTIGIVSWGVGCGQR 386
            |       ..|.:|  || .:||   .|..|:||.||||||:.|:.. .|...|:||||.|||:.
Mouse   241 CSQAYNSPNGSLIQ--PD-MLCA---RGPGDACQDDSGGPLVCQVAG-TWQQAGVVSWGEGCGRP 298

  Fly   387 GRPGIYTRVDRYLDWI 402
            .|||:|.||..|::||
Mouse   299 DRPGVYARVTAYVNWI 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 86/244 (35%)
Tryp_SPc 176..402 CDD:238113 85/241 (35%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 87/245 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842933
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.