DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and TPSG1

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:263 Identity:99/263 - (37%)
Similarity:129/263 - (49%) Gaps:45/263 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 GCG--ITSRQFPRLTGGRPAEPDEWPWMAALLQEGLPFVWCGGVLITDRHVLTAAHCIY-KKNKE 224
            |||  ..|....|:.||..|....|||.|:|....:..  |||.|::.:.|||||||.. ..|..
Human    50 GCGRPQVSDAGGRIVGGHAAPAGAWPWQASLRLRRVHV--CGGSLLSPQWVLTAAHCFSGSLNSS 112

  Fly   225 DIFVRLGEYNTHMLNETRARDF-RIANMVLHIDYNPQ-NYDNDIAIVRIDRATIFNTYIWPVCMP 287
            |..|.|||     |..|.:..| .:..::||...:.| ....|||:|.:......::.|.|||:|
Human   113 DYQVHLGE-----LEITLSPHFSTVRQIILHSSPSGQPGTSGDIALVELSVPVTLSSRILPVCLP 172

  Fly   288 PVNED-------WSDRNAIVTGWGTQKFG----GPHSNILMEVNLPVWKQSDCR-------SSFV 334
            ..::|       |      |||||..:.|    .|:|  |.||.:.|.....||       .|.:
Human   173 EASDDFCPGIRCW------VTGWGYTREGEPLPPPYS--LREVKVSVVDTETCRRDYPGPGGSIL 229

  Fly   335 QHVPDTAMCAGFPEGGQDSCQGDSGGPLLVQLPNQRWVTIGIVSWGVGCGQRGRPGIYTRVDRYL 399
            |  || .:||   .|..|:||.||||||:.|: |..||..|.||||.|||:..|||:||||..|:
Human   230 Q--PD-MLCA---RGPGDACQDDSGGPLVCQV-NGAWVQAGTVSWGEGCGRPNRPGVYTRVPAYV 287

  Fly   400 DWI 402
            :||
Human   288 NWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 93/249 (37%)
Tryp_SPc 176..402 CDD:238113 92/246 (37%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 93/249 (37%)
Tryp_SPc 63..293 CDD:238113 94/250 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152861
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.