DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and CG30002

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001163100.1 Gene:CG30002 / 246384 FlyBaseID:FBgn0260474 Length:311 Species:Drosophila melanogaster


Alignment Length:276 Identity:92/276 - (33%)
Similarity:132/276 - (47%) Gaps:49/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 QRGCGITSRQFP------RLTGGRPAEPDEWPWMAAL-LQEGLPFVWCGGVLITDRHVLTAAHC- 217
            |:.||:.|.|.|      .:||||.:.....||||.| :...|....|||.||::..||||||| 
  Fly    43 QQDCGVRSNQIPAVRIRFMITGGRKSSLMSQPWMAFLHIASDLEMCRCGGSLISELFVLTAAHCF 107

  Fly   218 -IYKKNKEDIFVRLGE-----------YNTHMLNETRARDFRIANMVLHIDYNPQNYDNDIAIVR 270
             :..::|| |.|.|||           ||...:......:|.|...:||.::|......|||:::
  Fly   108 KMCPRSKE-IRVWLGELDLSSTSDCTTYNYERVCAPPVEEFTIDKWILHEEFNLFYPGYDIALIK 171

  Fly   271 IDRATIFNTYIWPVCMPPVNEDWS-----DRNAIVTGWG-TQKFGGPHSNILMEVNLPVWKQSDC 329
            :::..:|..:|.|:|:|..:|..:     .:..:..||| |:..  .::|..|||::...|.:|.
  Fly   172 LNKKVVFKDHIRPICLPLTDELLAFTLQLGQRFMAVGWGKTESL--RYANSTMEVDIRTEKCTDG 234

  Fly   330 RSSFVQHVPDTA-MCAGFPEGGQ--DSCQGDSGGPLL---VQLPNQRWVTIGIVSWG-VGCGQRG 387
            |        ||: :||    .|.  |:|.||||||||   ......|.|..|:||.| ..|| .|
  Fly   235 R--------DTSFLCA----SGDYVDTCNGDSGGPLLWKTTLFGKDRAVQFGVVSTGSQNCG-AG 286

  Fly   388 RPGIYTRVDRYLDWIL 403
            ....|..|..|:.|||
  Fly   287 HKAYYMDVPTYMPWIL 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 83/255 (33%)
Tryp_SPc 176..402 CDD:238113 82/252 (33%)
CG30002NP_001163100.1 Tryp_SPc 62..301 CDD:214473 83/254 (33%)
Tryp_SPc 62..301 CDD:238113 83/254 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.