DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and TPSD1

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:256 Identity:74/256 - (28%)
Similarity:112/256 - (43%) Gaps:67/256 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 SPQVVTSADGDEPRIVNKPEQRGCGITSRQFPRLTGGRPAEPDEWPWMAALLQEGLPFVW---CG 202
            ||..|..|.|      ...:|.|          :.||:.|...:|||..:|...| |: |   ||
Human    21 SPAYVAPAPG------QALQQTG----------IVGGQEAPRSKWPWQVSLRVRG-PY-WMHFCG 67

  Fly   203 GVLITDRHVLTAAHCIYKKNKEDIFVRLGEYNTHMLNETRARDFRIANMVLHIDYNPQNY----D 263
            |.||..:.|||||||:....|:...:|:.....|:..:.:.  ..::.:::|    ||.|    .
Human    68 GSLIHPQWVLTAAHCVEPDIKDLAALRVQLREQHLYYQDQL--LPVSRIIVH----PQFYIIQTG 126

  Fly   264 NDIAIVRIDRATIFNTYIWPVCMPPVNED-------WSDRNAIVTGWGTQKFGGPHSNI------ 315
            .|||::.::.....:::|..|.:||.:|.       |      ||||     |...:|:      
Human   127 ADIALLELEEPVNISSHIHTVTLPPASETFPPGMPCW------VTGW-----GDVDNNVHLPPPY 180

  Fly   316 -LMEVNLPVWKQSDCRSSF---------VQHVPDTAMCAGFPEGGQDSCQGDSGGPLLVQL 366
             |.||.:||.:...|.:.:         .|.|.|..:|||  ....|||||||||||:.::
Human   181 PLKEVEVPVVENHLCNAEYHTGLHTGHSFQIVRDDMLCAG--SENHDSCQGDSGGPLVCKV 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 67/224 (30%)
Tryp_SPc 176..402 CDD:238113 67/221 (30%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 67/223 (30%)
Tryp_SPc 38..240 CDD:214473 67/223 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152881
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.