DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and F7

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_011535776.2 Gene:F7 / 2155 HGNCID:3544 Length:495 Species:Homo sapiens


Alignment Length:451 Identity:124/451 - (27%)
Similarity:189/451 - (41%) Gaps:119/451 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DEFQWGESENQVYENRTGENRVVSFLSQHRLNKRQAPTSQL--LENKDYGAC-STPLGESGRCR- 98
            :|.:.|..|.:..|.:      .||.....:.| .|..::|  :...|...| |:|....|.|: 
Human    59 EELRPGSLERECKEEQ------CSFEEAREIFK-DAERTKLFWISYSDGDQCASSPCQNGGSCKD 116

  Fly    99 ----HIIYCRMP-----------------ELKNDV--W----RLVSQLCII------EKSSIGIC 130
                :|.:| :|                 .||.:.  |    |:...||..      :|....||
Human   117 QLQSYICFC-LPAFEGRNCETQESPASWRRLKREASCWSSGSRMPGDLCSALVPSSPDKDDQLIC 180

  Fly   131 ----------CTDQSTSNR-------FSPQVVTSADGD----------------EPRIVNKPEQR 162
                      |:|.:.:.|       :|    ..|||.                |.|..:||:  
Human   181 VNENGGCEQYCSDHTGTKRSCRCHEGYS----LLADGVSCTPTVEYPCGKIPILEKRNASKPQ-- 239

  Fly   163 GCGITSRQFPRLTGGRPAEPDEWPWMAALLQEGLPFVWCGGVLITDRHVLTAAHCIYK-KNKEDI 226
                     .|:.||:.....|.||...||..|...  |||.||....|::||||..| ||..::
Human   240 ---------GRIVGGKVCPKGECPWQVLLLVNGAQL--CGGTLINTIWVVSAAHCFDKIKNWRNL 293

  Fly   227 FVRLGEYNTHMLNE----TRARDFRIANMVLHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCMP 287
            ...|||   |.|:|    .::|  |:|.:::...|.|...::|||::|:.:..:...::.|:|:|
Human   294 IAVLGE---HDLSEHDGDEQSR--RVAQVIIPSTYVPGTTNHDIALLRLHQPVVLTDHVVPLCLP 353

  Fly   288 PVNEDWSDRN------AIVTGWGTQKFGGPHSNILMEVNLPVWKQSDC--RSSFVQHVPDTA--- 341
              ...:|:|.      ::|:|||.....|..:..||.:|:|.....||  :|..|...|:..   
Human   354 --ERTFSERTLAFVRFSLVSGWGQLLDRGATALELMVLNVPRLMTQDCLQQSRKVGDSPNITEYM 416

  Fly   342 MCAGFPEGGQDSCQGDSGGPLLVQLPNQRWVTIGIVSWGVGCGQRGRPGIYTRVDRYLDWI 402
            .|||:.:|.:|||:||||||..... ...|...||||||.||...|..|:||||.:|::|:
Human   417 FCAGYSDGSKDSCKGDSGGPHATHY-RGTWYLTGIVSWGQGCATVGHFGVYTRVSQYIEWL 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829 17/89 (19%)
Tryp_SPc 173..402 CDD:214473 85/244 (35%)
Tryp_SPc 176..402 CDD:238113 84/241 (35%)
F7XP_011535776.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D245876at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.