DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and try-1

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:286 Identity:98/286 - (34%)
Similarity:136/286 - (47%) Gaps:51/286 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 IVNKP---------EQRGCGI----------TSRQFP--------RLTGGRPAEPDEWPWMAALL 192
            ::||.         |:.|||:          .|.|.|        ||.||..:.|..|||...||
 Worm    12 VINKVSTDNKNDVIEKVGCGLHSTNVELAQTRSAQEPADYVTLDHRLIGGSESSPHSWPWTVQLL 76

  Fly   193 QEGLPFVWCGGVLITDRHVLTAAHCIYKKNKEDIF-VRLGEYNTHMLNETRARDFRIANMVLHID 256
            .. |....|||.||....|||||||..|..:...: ||:|.:.:     ......|:..:.:|..
 Worm    77 SR-LGHHRCGGSLIDPNFVLTAAHCFAKDRRPTSYSVRVGGHRS-----GSGSPHRVTAVSIHPW 135

  Fly   257 YN---PQNYDNDIAIVRIDRATIFNTYIWPVCMP--PVNEDWSDRNAIVTGWGTQKFGGPHS-NI 315
            ||   |.:|  |.||:||......:|...|:|:|  |..|   :|..:|||||:...|...| ..
 Worm   136 YNIGFPSSY--DFAIMRIHPPVNTSTTARPICLPSLPAVE---NRLCVVTGWGSTIEGSSLSAPT 195

  Fly   316 LMEVNLPVWKQSDCRS--SFVQ--HVPDTAMCAGFPEGGQDSCQGDSGGPLLVQLPNQRWVTIGI 376
            |.|:::|:.....|.|  :::.  |:| :.:|||:..|..|||||||||||:. ..:..|...|:
 Worm   196 LREIHVPLLSTLFCSSLPNYIGRIHLP-SMLCAGYSYGKIDSCQGDSGGPLMC-ARDGHWELTGV 258

  Fly   377 VSWGVGCGQRGRPGIYTRVDRYLDWI 402
            ||||:||.:.|.||:|..|.....||
 Worm   259 VSWGIGCARPGMPGVYGNVHSASTWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 87/239 (36%)
Tryp_SPc 176..402 CDD:238113 85/236 (36%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 87/239 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 147 1.000 Domainoid score I2768
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I2933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.