DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and Tpsb2

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:270 Identity:90/270 - (33%)
Similarity:133/270 - (49%) Gaps:50/270 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 KPEQRGCGITSRQFPRLTGGRPAEPDEWPWMAAL---LQEGLPFVWCGGVLITDRHVLTAAHCI- 218
            :|..:..||        .||..|...:|||..:|   |...:.|  |||.||..:.|||||||: 
Mouse    24 RPANQRVGI--------VGGHEASESKWPWQVSLRFKLNYWIHF--CGGSLIHPQWVLTAAHCVG 78

  Fly   219 -YKKNKEDIFVRLGE----YNTHMLNETRARDFRIANMVLHIDYNPQNYDNDIAIVRIDRATIFN 278
             :.|:.:...|:|.|    |...:|:..|        :|:|..|.......|:|::.::.....:
Mouse    79 PHIKSPQLFRVQLREQYLYYGDQLLSLNR--------IVVHPHYYTAEGGADVALLELEVPVNVS 135

  Fly   279 TYIWPVCMPPVNEDWSDRNAI-VTGWG----TQKFGGPHSNILMEVNLPVWKQSDCRSSFVQH-- 336
            |::.|:.:||.:|.:....:. |||||    .:....|:.  |.:|.:|:.:.|.|...:  |  
Mouse   136 THLHPISLPPASETFPPGTSCWVTGWGDIDNDEPLPPPYP--LKQVKVPIVENSLCDRKY--HTG 196

  Fly   337 ---------VPDTAMCAGFPEGGQDSCQGDSGGPLLVQLPNQRWVTIGIVSWGVGCGQRGRPGIY 392
                     |.|..:|||  ...:|||||||||||:.::.. .|:..|:||||.||.|..:||||
Mouse   197 LYTGDDFPIVHDGMLCAG--NTRRDSCQGDSGGPLVCKVKG-TWLQAGVVSWGEGCAQPNKPGIY 258

  Fly   393 TRVDRYLDWI 402
            |||..|||||
Mouse   259 TRVTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 85/253 (34%)
Tryp_SPc 176..402 CDD:238113 85/250 (34%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 88/262 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842950
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.