DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and Tmprss2

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_008766769.1 Gene:Tmprss2 / 156435 RGDID:620766 Length:580 Species:Rattus norvegicus


Alignment Length:397 Identity:120/397 - (30%)
Similarity:183/397 - (46%) Gaps:81/397 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 WGESENQVYENRTGENRVV-----SFLSQHRLNKRQA--PTSQLLENKDYGACSTPLGESGRCRH 99
            |.:..:|. .|...|||.|     ||..|...::|:|  |..|...|:.||..:        |:.
  Rat   131 WCDGVSQC-PNGEDENRCVRLYGTSFTLQVYSSQRKAWYPVCQDDWNESYGRAA--------CKD 186

  Fly   100 IIYCRMPELKNDVWRLVSQLCIIEKSSIGICCTDQSTSNRFSPQVVTS-----------ADGDEP 153
            :.|      ||..:           ||.||  .|||.:..|....|::           :|....
  Rat   187 MGY------KNSFY-----------SSQGI--PDQSGATSFMKLNVSAGNVDLYKKLYHSDSCSS 232

  Fly   154 RIVNKPEQRGCGITS-RQFPRLTGGRPAEPDEWPWMAALLQEGLPFVWCGGVLITDRHVLTAAHC 217
            |:|.......||:.| |:..|:.||..|.|.:|||..:|..:|:..  |||.:||...::|||||
  Rat   233 RMVVSLRCIECGVRSVRRQSRIVGGSTASPGDWPWQVSLHVQGIHV--CGGSIITPEWIVTAAHC 295

  Fly   218 IYKKNKEDI--------FVRLGEYNTHMLNETRARDFRIANMVLHIDYNPQNYDNDIAIVRIDRA 274
            :    :|.:        |..:.:.:. |...:|   .::..::.|.:|:.:..:||||::::...
  Rat   296 V----EEPLSSPRYWTAFAGILKQSL-MFYGSR---HQVEKVISHPNYDSKTKNNDIALMKLQTP 352

  Fly   275 TIFNTYIWPVCMPP-------VNEDWSDRNAIVTGWGTQKFGGPHSNILMEVNLPVWKQSDCRSS 332
            ..||..:.|||:|.       ..|.|      ::|||.....|..|::|....:|:.:.|.|.|.
  Rat   353 LAFNDVVKPVCLPNPGMMLDLAQECW------ISGWGATYEKGKTSDVLNAAMVPLIEPSKCNSK 411

  Fly   333 FVQH--VPDTAMCAGFPEGGQDSCQGDSGGPLLVQLPNQRWVTIGIVSWGVGCGQRGRPGIYTRV 395
            ::.:  :....:||||.:|..|||||||||| ||.|.|:.|..||..|||.||.:..|||:|..|
  Rat   412 YIYNNLITPAMICAGFLQGSVDSCQGDSGGP-LVTLKNEIWWLIGDTSWGSGCAKAYRPGVYGNV 475

  Fly   396 DRYLDWI 402
            ..:.|||
  Rat   476 TVFTDWI 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829 8/44 (18%)
Tryp_SPc 173..402 CDD:214473 81/245 (33%)
Tryp_SPc 176..402 CDD:238113 80/242 (33%)
Tmprss2XP_008766769.1 LDLa 112..147 CDD:238060 5/16 (31%)
SRCR_2 152..247 CDD:292133 28/121 (23%)
Tryp_SPc 253..482 CDD:214473 81/245 (33%)
Tryp_SPc 254..485 CDD:238113 82/246 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45531
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.